Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2246338..2246864 | Replicon | chromosome |
| Accession | NZ_LR213452 | ||
| Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | E0E33_RS11520 | Protein ID | WP_000323025.1 |
| Coordinates | 2246338..2246625 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | E0E33_RS11525 | Protein ID | WP_000534858.1 |
| Coordinates | 2246625..2246864 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E33_RS11465 | 2241396..2241731 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
| E0E33_RS11470 | 2242012..2242120 | - | 109 | Protein_2185 | DUF3927 family protein | - |
| E0E33_RS11490 | 2243041..2243862 | - | 822 | WP_000762884.1 | antitermination protein | - |
| E0E33_RS11495 | 2243877..2244233 | - | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E0E33_RS11500 | 2244246..2245295 | - | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
| E0E33_RS11505 | 2245297..2245575 | - | 279 | Protein_2189 | hypothetical protein | - |
| E0E33_RS11510 | 2245678..2245893 | - | 216 | WP_000980986.1 | hypothetical protein | - |
| E0E33_RS11515 | 2246111..2246266 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| E0E33_RS11520 | 2246338..2246625 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| E0E33_RS11525 | 2246625..2246864 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| E0E33_RS11530 | 2246889..2247194 | + | 306 | WP_071818640.1 | hypothetical protein | - |
| E0E33_RS11535 | 2247191..2248069 | - | 879 | Protein_2195 | IS3-like element IS600 family transposase | - |
| E0E33_RS11540 | 2248087..2248784 | - | 698 | Protein_2196 | IS1 family transposase | - |
| E0E33_RS11545 | 2248841..2249269 | + | 429 | Protein_2197 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2238199..2251882 | 13683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T288249 WP_000323025.1 NZ_LR213452:c2246625-2246338 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|