Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 1564323..1564889 Replicon chromosome
Accession NZ_LR134354
Organism Bifidobacterium longum subsp. infantis strain NCTC11817

Toxin (Protein)


Gene name relE Uniprot ID W6EX94
Locus tag EL189_RS07665 Protein ID WP_003831807.1
Coordinates 1564596..1564889 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag EL189_RS07660 Protein ID WP_014484914.1
Coordinates 1564323..1564592 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL189_RS07635 1560073..1560767 - 695 Protein_1416 response regulator transcription factor -
EL189_RS07640 1560893..1561408 + 516 WP_013140733.1 hypothetical protein -
EL189_RS07645 1561405..1562295 + 891 WP_014484913.1 hypothetical protein -
EL189_RS07650 1562292..1562972 + 681 WP_003829413.1 ABC transporter ATP-binding protein -
EL189_RS07655 1562969..1564138 + 1170 WP_012577732.1 ABC transporter permease -
EL189_RS07660 1564323..1564592 + 270 WP_014484914.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
EL189_RS07665 1564596..1564889 + 294 WP_003831807.1 type II toxin-antitoxin system YafQ family toxin Toxin
EL189_RS07670 1564947..1565227 + 281 Protein_1423 hypothetical protein -
EL189_RS07675 1565558..1566109 + 552 WP_012577735.1 RNA polymerase sigma factor -
EL189_RS07680 1566143..1566970 + 828 WP_012577736.1 hypothetical protein -
EL189_RS07685 1567102..1567728 + 627 WP_012577737.1 hypothetical protein -
EL189_RS07690 1567725..1568507 + 783 WP_012577738.1 hypothetical protein -
EL189_RS07695 1568560..1569435 + 876 WP_003829425.1 ABC transporter ATP-binding protein -
EL189_RS07700 1569489..1569887 + 399 WP_003829426.1 superoxide dismutase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 1555338..1576696 21358


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-95)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-87)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11218.98 Da        Isoelectric Point: 9.7881

>T287797 WP_003831807.1 NZ_LR134354:1564596-1564889 [Bifidobacterium longum subsp. infantis]
MLKPDYTAAFQRDIKKLKRKHTDLRPLKEVIRLVLEDTADSKEVLRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK

Download         Length: 294 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 9902.25 Da        Isoelectric Point: 4.7872

>AT287797 WP_014484914.1 NZ_LR134354:1564323-1564592 [Bifidobacterium longum subsp. infantis]
VSMASVTVRVDADTKQKAANIAEDLGLDLSSVTRAFYKQIVRERRIPLNLSYTTVPPETMEALDEAKNRLADGKPRFNSA
DEMFDSLVI

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W6EX94

Antitoxin

Source ID Structure

References