Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1903261..1903443 Replicon chromosome
Accession NZ_LR134085
Organism Staphylococcus aureus strain NCTC12233

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag ELZ52_RS09670 Protein ID WP_001801861.1
Coordinates 1903261..1903356 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1903384..1903443 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ52_RS09620 1898921..1899547 + 627 WP_000669046.1 hypothetical protein -
ELZ52_RS09625 1899588..1899932 + 345 WP_000627551.1 DUF3969 family protein -
ELZ52_RS09630 1900030..1900581 + 552 WP_000414205.1 hypothetical protein -
ELZ52_RS09635 1900799..1901440 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
ELZ52_RS09640 1901554..1901739 - 186 WP_000809857.1 hypothetical protein -
ELZ52_RS09645 1901741..1901917 - 177 WP_000375476.1 hypothetical protein -
ELZ52_RS09650 1901928..1902311 - 384 WP_000070811.1 hypothetical protein -
ELZ52_RS09660 1902915..1903058 - 144 WP_001549059.1 transposase -
ELZ52_RS09670 1903261..1903356 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1903384..1903443 - 60 - - Antitoxin
ELZ52_RS09675 1903479..1903580 + 102 WP_001791893.1 hypothetical protein -
ELZ52_RS09680 1903558..1903734 - 177 Protein_1815 transposase -
ELZ52_RS09685 1903928..1904305 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1896361..1936533 40172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286689 WP_001801861.1 NZ_LR134085:1903261-1903356 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT286689 NZ_LR134085:c1903443-1903384 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References