Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4424854..4425668 | Replicon | chromosome |
Accession | NZ_LR130564 | ||
Organism | Escherichia coli strain MS14387 isolate MS14387 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | FVE81_RS21580 | Protein ID | WP_001054376.1 |
Coordinates | 4424854..4425111 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | FVE81_RS21585 | Protein ID | WP_001309181.1 |
Coordinates | 4425123..4425668 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FVE81_RS21560 | 4420114..4421094 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
FVE81_RS21565 | 4421709..4422689 | - | 981 | WP_000019400.1 | IS5-like element IS5 family transposase | - |
FVE81_RS21570 | 4422876..4424116 | - | 1241 | Protein_4179 | helicase YjhR | - |
FVE81_RS21575 | 4424232..4424477 | + | 246 | Protein_4180 | GNAT family N-acetyltransferase | - |
FVE81_RS21580 | 4424854..4425111 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
FVE81_RS21585 | 4425123..4425668 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
FVE81_RS21590 | 4425724..4426470 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
FVE81_RS21595 | 4426639..4426857 | + | 219 | Protein_4184 | hypothetical protein | - |
FVE81_RS25995 | 4426895..4427011 | + | 117 | Protein_4185 | VOC family protein | - |
FVE81_RS21600 | 4427256..4428377 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
FVE81_RS21605 | 4428374..4428652 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
FVE81_RS21610 | 4428664..4429977 | + | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4416149..4433892 | 17743 | |
flank | IS/Tn | - | - | 4421709..4422689 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T286497 WP_001054376.1 NZ_LR130564:4424854-4425111 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT286497 WP_001309181.1 NZ_LR130564:4425123-4425668 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|