Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1947264..1947446 | Replicon | chromosome |
Accession | NZ_LR130518 | ||
Organism | Staphylococcus aureus strain BPH2986 isolate BPH2986 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EW031_RS10030 | Protein ID | WP_001801861.1 |
Coordinates | 1947264..1947359 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1947387..1947446 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW031_RS09980 | 1942924..1943550 | + | 627 | Protein_1880 | hypothetical protein | - |
EW031_RS09985 | 1943591..1943935 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
EW031_RS09990 | 1944033..1944584 | + | 552 | WP_000414205.1 | hypothetical protein | - |
EW031_RS09995 | 1944802..1945443 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
EW031_RS10000 | 1945557..1945742 | - | 186 | WP_000809857.1 | hypothetical protein | - |
EW031_RS10005 | 1945744..1945920 | - | 177 | WP_000375476.1 | hypothetical protein | - |
EW031_RS10010 | 1945931..1946314 | - | 384 | WP_000070811.1 | hypothetical protein | - |
EW031_RS10020 | 1946918..1947061 | - | 144 | WP_001549059.1 | transposase | - |
EW031_RS10030 | 1947264..1947359 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1947387..1947446 | - | 60 | - | - | Antitoxin |
EW031_RS10035 | 1947482..1947583 | + | 102 | WP_001791893.1 | hypothetical protein | - |
EW031_RS10040 | 1947561..1947737 | - | 177 | Protein_1890 | transposase | - |
EW031_RS10045 | 1947931..1948308 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1940364..1980536 | 40172 | ||
- | inside | Prophage | - | lukD / hlgA | 1909824..2028198 | 118374 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286180 WP_001801861.1 NZ_LR130518:1947264-1947359 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T286180 NZ_LR130518:1947264-1947359 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT286180 NZ_LR130518:c1947446-1947387 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|