Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1959503..1959685 | Replicon | chromosome |
| Accession | NZ_LR027878 | ||
| Organism | Staphylococcus aureus strain BPH2003 isolate BPH2003 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | E0E10_RS10025 | Protein ID | WP_001801861.1 |
| Coordinates | 1959503..1959598 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1959626..1959685 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E10_RS09975 | 1955163..1955789 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| E0E10_RS09980 | 1955830..1956174 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| E0E10_RS09985 | 1956272..1956823 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| E0E10_RS09990 | 1957041..1957682 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| E0E10_RS09995 | 1957796..1957981 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| E0E10_RS10000 | 1957983..1958159 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| E0E10_RS10005 | 1958170..1958553 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| E0E10_RS10015 | 1959157..1959300 | - | 144 | WP_001549059.1 | transposase | - |
| E0E10_RS10025 | 1959503..1959598 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1959626..1959685 | - | 60 | - | - | Antitoxin |
| E0E10_RS10030 | 1959721..1959822 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| E0E10_RS10035 | 1959800..1959976 | - | 177 | Protein_1885 | transposase | - |
| E0E10_RS10040 | 1960170..1960547 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| E0E10_RS10045 | 1961068..1962336 | - | 1269 | Protein_1887 | ATP-binding protein | - |
| E0E10_RS10055 | 1962388..1963559 | - | 1172 | Protein_1888 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1952603..1992853 | 40250 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286087 WP_001801861.1 NZ_LR027878:1959503-1959598 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT286087 NZ_LR027878:c1959685-1959626 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|