Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1959503..1959685 Replicon chromosome
Accession NZ_LR027878
Organism Staphylococcus aureus strain BPH2003 isolate BPH2003

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag E0E10_RS10025 Protein ID WP_001801861.1
Coordinates 1959503..1959598 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1959626..1959685 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E10_RS09975 1955163..1955789 + 627 WP_000669046.1 hypothetical protein -
E0E10_RS09980 1955830..1956174 + 345 WP_000627551.1 DUF3969 family protein -
E0E10_RS09985 1956272..1956823 + 552 WP_000414205.1 hypothetical protein -
E0E10_RS09990 1957041..1957682 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
E0E10_RS09995 1957796..1957981 - 186 WP_000809857.1 hypothetical protein -
E0E10_RS10000 1957983..1958159 - 177 WP_000375476.1 hypothetical protein -
E0E10_RS10005 1958170..1958553 - 384 WP_000070811.1 hypothetical protein -
E0E10_RS10015 1959157..1959300 - 144 WP_001549059.1 transposase -
E0E10_RS10025 1959503..1959598 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1959626..1959685 - 60 - - Antitoxin
E0E10_RS10030 1959721..1959822 + 102 WP_001791893.1 hypothetical protein -
E0E10_RS10035 1959800..1959976 - 177 Protein_1885 transposase -
E0E10_RS10040 1960170..1960547 - 378 WP_001037045.1 DUF1433 domain-containing protein -
E0E10_RS10045 1961068..1962336 - 1269 Protein_1887 ATP-binding protein -
E0E10_RS10055 1962388..1963559 - 1172 Protein_1888 IS256-like element IS256 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1952603..1992853 40250


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286087 WP_001801861.1 NZ_LR027878:1959503-1959598 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT286087 NZ_LR027878:c1959685-1959626 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References