Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1913277..1913459 Replicon chromosome
Accession NZ_LR027874
Organism Staphylococcus aureus strain BPH2056 isolate BPH2056

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag E0E13_RS09675 Protein ID WP_001801861.1
Coordinates 1913277..1913372 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1913400..1913459 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E13_RS09625 1908937..1909563 + 627 WP_000669046.1 hypothetical protein -
E0E13_RS09630 1909604..1909948 + 345 WP_000627551.1 DUF3969 family protein -
E0E13_RS09635 1910046..1910597 + 552 WP_000414205.1 hypothetical protein -
E0E13_RS09640 1910815..1911456 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
E0E13_RS09645 1911570..1911755 - 186 WP_000809857.1 hypothetical protein -
E0E13_RS09650 1911757..1911933 - 177 WP_000375476.1 hypothetical protein -
E0E13_RS09655 1911944..1912327 - 384 WP_000070811.1 hypothetical protein -
E0E13_RS09665 1912931..1913074 - 144 WP_001549059.1 transposase -
E0E13_RS09675 1913277..1913372 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1913400..1913459 - 60 - - Antitoxin
E0E13_RS09680 1913495..1913596 + 102 WP_001791893.1 hypothetical protein -
E0E13_RS09685 1913574..1913750 - 177 Protein_1822 transposase -
E0E13_RS09690 1913944..1914321 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1906377..1945296 38919


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286037 WP_001801861.1 NZ_LR027874:1913277-1913372 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT286037 NZ_LR027874:c1913459-1913400 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References