Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1913277..1913459 | Replicon | chromosome |
| Accession | NZ_LR027874 | ||
| Organism | Staphylococcus aureus strain BPH2056 isolate BPH2056 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | E0E13_RS09675 | Protein ID | WP_001801861.1 |
| Coordinates | 1913277..1913372 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1913400..1913459 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E13_RS09625 | 1908937..1909563 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| E0E13_RS09630 | 1909604..1909948 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| E0E13_RS09635 | 1910046..1910597 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| E0E13_RS09640 | 1910815..1911456 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| E0E13_RS09645 | 1911570..1911755 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| E0E13_RS09650 | 1911757..1911933 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| E0E13_RS09655 | 1911944..1912327 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| E0E13_RS09665 | 1912931..1913074 | - | 144 | WP_001549059.1 | transposase | - |
| E0E13_RS09675 | 1913277..1913372 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1913400..1913459 | - | 60 | - | - | Antitoxin |
| E0E13_RS09680 | 1913495..1913596 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| E0E13_RS09685 | 1913574..1913750 | - | 177 | Protein_1822 | transposase | - |
| E0E13_RS09690 | 1913944..1914321 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1906377..1945296 | 38919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286037 WP_001801861.1 NZ_LR027874:1913277-1913372 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT286037 NZ_LR027874:c1913459-1913400 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|