Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1947955..1948137 Replicon chromosome
Accession NZ_LR027873
Organism Staphylococcus aureus strain BPH2070 isolate BPH2070

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag E0E08_RS09875 Protein ID WP_001801861.1
Coordinates 1947955..1948050 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1948078..1948137 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E08_RS09825 1943615..1944241 + 627 WP_000669046.1 hypothetical protein -
E0E08_RS09830 1944282..1944626 + 345 WP_000627551.1 DUF3969 family protein -
E0E08_RS09835 1944724..1945275 + 552 WP_000414205.1 hypothetical protein -
E0E08_RS09840 1945493..1946134 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
E0E08_RS09845 1946248..1946433 - 186 WP_000809857.1 hypothetical protein -
E0E08_RS09850 1946435..1946611 - 177 WP_000375476.1 hypothetical protein -
E0E08_RS09855 1946622..1947005 - 384 WP_000070811.1 hypothetical protein -
E0E08_RS09865 1947609..1947752 - 144 WP_001549059.1 transposase -
E0E08_RS09875 1947955..1948050 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1948078..1948137 - 60 - - Antitoxin
E0E08_RS09880 1948173..1948274 + 102 WP_001791893.1 hypothetical protein -
E0E08_RS09885 1948252..1948428 - 177 Protein_1856 transposase -
E0E08_RS09890 1948622..1948999 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1941055..1979974 38919


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286025 WP_001801861.1 NZ_LR027873:1947955-1948050 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT286025 NZ_LR027873:c1948137-1948078 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References