Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1919774..1919956 Replicon chromosome
Accession NZ_LR027870
Organism Staphylococcus aureus strain BPH2019 isolate BPH2019

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag E0E15_RS09715 Protein ID WP_001801861.1
Coordinates 1919774..1919869 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1919897..1919956 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E15_RS09665 1915434..1916060 + 627 WP_000669046.1 hypothetical protein -
E0E15_RS09670 1916101..1916445 + 345 WP_000627551.1 DUF3969 family protein -
E0E15_RS09675 1916543..1917094 + 552 WP_000414205.1 hypothetical protein -
E0E15_RS09680 1917312..1917953 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
E0E15_RS09685 1918067..1918252 - 186 WP_000809857.1 hypothetical protein -
E0E15_RS09690 1918254..1918430 - 177 WP_000375476.1 hypothetical protein -
E0E15_RS09695 1918441..1918824 - 384 WP_000070811.1 hypothetical protein -
E0E15_RS09705 1919428..1919571 - 144 WP_001549059.1 transposase -
E0E15_RS09715 1919774..1919869 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1919897..1919956 - 60 - - Antitoxin
E0E15_RS09720 1919992..1920093 + 102 WP_001791893.1 hypothetical protein -
E0E15_RS09725 1920071..1920247 - 177 Protein_1825 transposase -
E0E15_RS09730 1920441..1920818 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA 1912874..1953126 40252


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286011 WP_001801861.1 NZ_LR027870:1919774-1919869 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT286011 NZ_LR027870:c1919956-1919897 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References