Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2884231..2884813 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | D3VJ77 |
Locus tag | XNC2_RS12065 | Protein ID | WP_013184681.1 |
Coordinates | 2884231..2884518 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | XNC2_RS12070 | Protein ID | WP_010846808.1 |
Coordinates | 2884529..2884813 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS23485 | 2880867..2881091 | + | 225 | WP_010846802.1 | hypothetical protein | - |
XNC2_RS20875 | 2881215..2882086 | + | 872 | Protein_2387 | IS630 family transposase | - |
XNC2_RS12045 | 2882416..2882841 | - | 426 | WP_012987825.1 | type II toxin-antitoxin system VapC family toxin | - |
XNC2_RS12050 | 2882841..2883095 | - | 255 | WP_010846804.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
XNC2_RS12055 | 2883320..2883649 | + | 330 | WP_010846805.1 | type I toxin-antitoxin system SymE family toxin | - |
XNC2_RS12060 | 2883790..2884128 | + | 339 | WP_010846806.1 | SymE family type I addiction module toxin | - |
XNC2_RS12065 | 2884231..2884518 | + | 288 | WP_013184681.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
XNC2_RS12070 | 2884529..2884813 | + | 285 | WP_010846808.1 | putative addiction module antidote protein | Antitoxin |
XNC2_RS12075 | 2884896..2885279 | - | 384 | WP_013184682.1 | hypothetical protein | - |
XNC2_RS12080 | 2885400..2885609 | - | 210 | WP_013184683.1 | hypothetical protein | - |
XNC2_RS12085 | 2885820..2886134 | - | 315 | WP_013184684.1 | hypothetical protein | - |
XNC2_RS12090 | 2886138..2886662 | - | 525 | WP_013184685.1 | hypothetical protein | - |
XNC2_RS23490 | 2886666..2886776 | - | 111 | Protein_2398 | RHS repeat protein | - |
XNC2_RS12105 | 2887274..2887465 | - | 192 | WP_143767649.1 | hypothetical protein | - |
XNC2_RS12110 | 2887495..2888496 | - | 1002 | WP_013184689.1 | site-specific tyrosine recombinase XerC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | - | 2878955..2939670 | 60715 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10773.43 Da Isoelectric Point: 10.0371
>T285555 WP_013184681.1 NZ_LN681227:2884231-2884518 [Xenorhabdus nematophila AN6/1]
MITIERTQNFEKWLKSLKDRIAKAKILIRVERMGEGNFGDVESVGGGVSELRIHYGQGYRVYFTNKNNEIILLLCGGDKS
SQQADIKKAKQLAKE
MITIERTQNFEKWLKSLKDRIAKAKILIRVERMGEGNFGDVESVGGGVSELRIHYGQGYRVYFTNKNNEIILLLCGGDKS
SQQADIKKAKQLAKE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|