Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 2320543..2321174 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | XNC2_RS10020 | Protein ID | WP_113967504.1 |
Coordinates | 2320543..2320821 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | D3VGL4 |
Locus tag | XNC2_RS10025 | Protein ID | WP_013184418.1 |
Coordinates | 2320818..2321174 (+) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS10000 | 2316532..2317149 | + | 618 | WP_013184413.1 | hypothetical protein | - |
XNC2_RS10005 | 2317131..2317364 | + | 234 | WP_013184414.1 | hypothetical protein | - |
XNC2_RS10010 | 2317364..2319550 | + | 2187 | WP_013184415.1 | DNA topoisomerase 3 | - |
XNC2_RS10015 | 2319608..2319907 | + | 300 | Protein_1984 | transposase | - |
XNC2_RS10020 | 2320543..2320821 | + | 279 | WP_113967504.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
XNC2_RS10025 | 2320818..2321174 | + | 357 | WP_013184418.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
XNC2_RS10030 | 2321620..2322330 | - | 711 | WP_013184420.1 | portal protein | - |
XNC2_RS10035 | 2322336..2322728 | - | 393 | Protein_1988 | transposase | - |
XNC2_RS10040 | 2322887..2323633 | + | 747 | Protein_1989 | IS630 family transposase | - |
XNC2_RS10045 | 2323635..2324684 | + | 1050 | Protein_1990 | Tn3 family transposase | - |
XNC2_RS10050 | 2324769..2325791 | + | 1023 | WP_010845954.1 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | - | 2312102..2348646 | 36544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10130.58 Da Isoelectric Point: 10.6521
>T285554 WP_113967504.1 NZ_LN681227:2320543-2320821 [Xenorhabdus nematophila AN6/1]
MNKQVSALRTRQQRTLEQIFKTPVSSGIKWSDIESLIKALGGEIKEGRGSRCKFLLNGSIANFHRPHPSPDTDKGAVAGL
REWLESIGVTPS
MNKQVSALRTRQQRTLEQIFKTPVSSGIKWSDIESLIKALGGEIKEGRGSRCKFLLNGSIANFHRPHPSPDTDKGAVAGL
REWLESIGVTPS
Download Length: 279 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13289.10 Da Isoelectric Point: 5.6614
>AT285554 WP_013184418.1 NZ_LN681227:2320818-2321174 [Xenorhabdus nematophila AN6/1]
MSKQNTNIMEIAGLSAVISYVPELGMFRGKFLGLSGYCDFVADSIAGLHAEGRLSLDEYLEDCRAANIEPYQKREKTKTF
TLRYPESFGERLNQAATEHHISVNAFILETLGERLRNI
MSKQNTNIMEIAGLSAVISYVPELGMFRGKFLGLSGYCDFVADSIAGLHAEGRLSLDEYLEDCRAANIEPYQKREKTKTF
TLRYPESFGERLNQAATEHHISVNAFILETLGERLRNI
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|