Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 489212..489707 Replicon chromosome
Accession NZ_LN681227
Organism Xenorhabdus nematophila AN6/1

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag XNC2_RS22035 Protein ID WP_081480213.1
Coordinates 489513..489707 (-) Length 65 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag XNC2_RS02470 Protein ID WP_010848973.1
Coordinates 489212..489511 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XNC2_RS02455 484801..486234 + 1434 WP_013183340.1 NAD-dependent succinate-semialdehyde dehydrogenase -
XNC2_RS21045 486259..486441 - 183 Protein_470 transposase -
XNC2_RS02460 486498..487640 + 1143 WP_013183341.1 transposase -
XNC2_RS02465 487819..488784 + 966 WP_010848971.1 PDR/VanB family oxidoreductase -
XNC2_RS21050 488817..489089 + 273 WP_013183342.1 hypothetical protein -
XNC2_RS02470 489212..489511 - 300 WP_010848973.1 XRE family transcriptional regulator Antitoxin
XNC2_RS22035 489513..489707 - 195 WP_081480213.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
XNC2_RS02475 489731..490519 - 789 WP_010848974.1 amino acid ABC transporter substrate-binding protein -
XNC2_RS02480 490573..491337 - 765 WP_010848975.1 amino acid ABC transporter ATP-binding protein -
XNC2_RS02485 491315..492031 - 717 WP_010848976.1 amino acid ABC transporter permease -
XNC2_RS02490 492315..493088 - 774 WP_013183344.1 amino acid ABC transporter substrate-binding protein -
XNC2_RS02495 493292..494000 - 709 Protein_480 transposase -
XNC2_RS21060 494009..494350 + 342 WP_013183347.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 486498..487640 1142


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(13-55)

Antitoxin

Cro/C1-type helix-turn-helix domain

(31-80)


Sequences

Toxin        


Download         Length: 65 a.a.        Molecular weight: 7507.59 Da        Isoelectric Point: 8.5012

>T285550 WP_081480213.1 NZ_LN681227:c489707-489513 [Xenorhabdus nematophila AN6/1]
IDYISIDCSLYTRTIRAFFAFDPERQAVVFCAGNKAGKNQKSFYRDMIKVADEQFRIHLNNLEK

Download         Length: 195 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10868.74 Da        Isoelectric Point: 8.4812

>AT285550 WP_010848973.1 NZ_LN681227:c489511-489212 [Xenorhabdus nematophila AN6/1]
MATLKELMAKRSPESQAKIEEKAAEMLLETQLYQIREALALSQTQVAKNLGIAQSSVAAIEQRGNELKISTLKKYIEAMG
GEMTLGVKLPDGKLMNFSI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References