Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 179959..180575 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | doc | Uniprot ID | D3VH06 |
Locus tag | XNC2_RS00880 | Protein ID | WP_013183155.1 |
Coordinates | 180177..180575 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | N1NKK1 |
Locus tag | XNC2_RS00875 | Protein ID | WP_010847654.1 |
Coordinates | 179959..180180 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS20970 | 175854..176066 | + | 213 | WP_013183151.1 | ogr/Delta-like zinc finger family protein | - |
XNC2_RS00860 | 176776..177591 | + | 816 | WP_010847649.1 | DNA damage-inducible protein D | - |
XNC2_RS00865 | 177930..178490 | + | 561 | Protein_171 | DUF4102 domain-containing protein | - |
XNC2_RS00870 | 178698..179738 | - | 1041 | WP_013141539.1 | IS481 family transposase | - |
XNC2_RS00875 | 179959..180180 | + | 222 | WP_010847654.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
XNC2_RS00880 | 180177..180575 | + | 399 | WP_013183155.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
XNC2_RS00885 | 180817..181716 | - | 900 | Protein_175 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
XNC2_RS00890 | 181779..182555 | - | 777 | WP_010847657.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
XNC2_RS00895 | 183071..183838 | - | 768 | WP_013183157.1 | triose-phosphate isomerase | - |
XNC2_RS00900 | 183927..184547 | - | 621 | WP_013183158.1 | DUF1454 family protein | - |
XNC2_RS00905 | 184606..185052 | + | 447 | WP_041573628.1 | DUF805 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 163360..180575 | 17215 | ||
flank | IS/Tn | - | - | 178698..179738 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14931.84 Da Isoelectric Point: 6.3262
>T285547 WP_013183155.1 NZ_LN681227:180177-180575 [Xenorhabdus nematophila AN6/1]
MIWVSAQEVIAFHDRILQRLPGVAGMPDSGRAEALIYRVQNRTHHEGITDIFELAATYWAAIARGHIFNDGNKRTAFFVT
MTFLYRNGIKIRDNDNTLENLTVDAATGEKTVDQLAQHLRELVDYTNPSCNP
MIWVSAQEVIAFHDRILQRLPGVAGMPDSGRAEALIYRVQNRTHHEGITDIFELAATYWAAIARGHIFNDGNKRTAFFVT
MTFLYRNGIKIRDNDNTLENLTVDAATGEKTVDQLAQHLRELVDYTNPSCNP
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|