Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 3337427..3337642 | Replicon | chromosome |
Accession | NZ_LN614756 | ||
Organism | Clostridioides difficile strain 630Derm |
Toxin (Protein)
Gene name | CD2889 | Uniprot ID | Q183X5 |
Locus tag | CD630DERM_RS21030 | Protein ID | WP_011861731.1 |
Coordinates | 3337499..3337642 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 3337427..3337573 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CD630DERM_RS15480 | 3333086..3334240 | + | 1155 | WP_003439713.1 | GGDEF domain-containing protein | - |
CD630DERM_RS15485 | 3334321..3336039 | - | 1719 | WP_011861730.1 | putative 2-aminoethylphosphonate ABC transporter permease subunit | - |
CD630DERM_RS15490 | 3336044..3336925 | - | 882 | Protein_2954 | ATP-binding cassette domain-containing protein | - |
- | 3337427..3337573 | + | 147 | NuclAT_2 | - | Antitoxin |
- | 3337427..3337577 | + | 151 | NuclAT_1 | - | - |
CD630DERM_RS21030 | 3337499..3337642 | - | 144 | WP_011861731.1 | hypothetical protein | Toxin |
CD630DERM_RS15500 | 3337900..3338088 | + | 189 | WP_009898401.1 | hypothetical protein | - |
CD630DERM_RS15505 | 3338335..3339039 | - | 705 | WP_011861732.1 | hypothetical protein | - |
CD630DERM_RS15510 | 3339041..3339472 | - | 432 | WP_011861052.1 | protein-export chaperone SecB | - |
CD630DERM_RS15515 | 3339490..3340053 | - | 564 | WP_021371073.1 | hypothetical protein | - |
CD630DERM_RS15520 | 3340599..3340895 | - | 297 | WP_011861049.1 | hypothetical protein | - |
CD630DERM_RS15525 | 3340912..3341727 | - | 816 | WP_011861048.1 | N-acetylmuramoyl-L-alanine amidase | - |
CD630DERM_RS15530 | 3341724..3341984 | - | 261 | WP_011861047.1 | phage holin family protein | - |
CD630DERM_RS15535 | 3342004..3342234 | - | 231 | WP_011861046.1 | hemolysin XhlA family protein | - |
CD630DERM_RS15540 | 3342269..3342451 | - | 183 | WP_011861045.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T285475 WP_011861731.1 NZ_LN614756:c3337642-3337499 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
Antitoxin
Download Length: 147 bp
>AT285475 NZ_LN614756:3337427-3337573 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|