Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2865442..2865651 | Replicon | chromosome |
Accession | NZ_LN614756 | ||
Organism | Clostridioides difficile strain 630Derm |
Toxin (Protein)
Gene name | CD2517.1 | Uniprot ID | Q182K5 |
Locus tag | CD630DERM_RS21015 | Protein ID | WP_004454815.1 |
Coordinates | 2865493..2865651 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 2865442..2865576 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CD630DERM_RS13560 | 2861012..2862640 | + | 1629 | WP_004454813.1 | aspartate 4-decarboxylase | - |
CD630DERM_RS13565 | 2862761..2863756 | + | 996 | WP_003431031.1 | asparaginase | - |
CD630DERM_RS13570 | 2863934..2864317 | - | 384 | WP_011861577.1 | BlaI/MecI/CopY family transcriptional regulator | - |
- | 2865442..2865576 | + | 135 | NuclAT_4 | - | Antitoxin |
CD630DERM_RS21015 | 2865493..2865651 | - | 159 | WP_004454815.1 | hypothetical protein | Toxin |
CD630DERM_RS13580 | 2866010..2867380 | - | 1371 | WP_011861578.1 | cell wall-binding protein Cwp29 | - |
CD630DERM_RS13585 | 2867594..2868712 | + | 1119 | WP_011861579.1 | site-specific integrase | - |
CD630DERM_RS13590 | 2869029..2869697 | - | 669 | WP_011861580.1 | VanZ family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5996.20 Da Isoelectric Point: 11.3102
>T285473 WP_004454815.1 NZ_LN614756:c2865651-2865493 [Clostridioides difficile]
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
Download Length: 159 bp
Antitoxin
Download Length: 135 bp
>AT285473 NZ_LN614756:2865442-2865576 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|