Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1650060..1650256 | Replicon | chromosome |
Accession | NZ_LN614756 | ||
Organism | Clostridioides difficile strain 630Derm |
Toxin (Protein)
Gene name | CD1418.2 | Uniprot ID | Q18BT8 |
Locus tag | CD630DERM_RS20915 | Protein ID | WP_009902496.1 |
Coordinates | 1650060..1650212 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | CD630_n00500 | ||
Locus tag | - | ||
Coordinates | 1650156..1650256 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CD630DERM_RS07955 | 1645600..1646193 | - | 594 | WP_003438546.1 | DUF308 domain-containing protein | - |
CD630DERM_RS07960 | 1646300..1646728 | + | 429 | WP_011861207.1 | DMT family transporter | - |
CD630DERM_RS07965 | 1646795..1647463 | + | 669 | WP_003429358.1 | diphthine--ammonia ligase | - |
CD630DERM_RS07970 | 1647581..1648936 | - | 1356 | WP_003438549.1 | MATE family efflux transporter | - |
CD630DERM_RS20915 | 1650060..1650212 | + | 153 | WP_009902496.1 | hypothetical protein | Toxin |
- | 1650156..1650256 | - | 101 | NuclAT_15 | - | Antitoxin |
CD630DERM_RS07980 | 1651642..1653375 | - | 1734 | WP_009902497.1 | diguanylate cyclase | - |
CD630DERM_RS07985 | 1653615..1654460 | - | 846 | WP_009889222.1 | GGDEF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5742.81 Da Isoelectric Point: 10.9178
>T285470 WP_009902496.1 NZ_LN614756:1650060-1650212 [Clostridioides difficile]
MDNFLQGVLASLVASLIVYLNSKLFKKVKSHSGRSDFSFELKIKFKKNKH
MDNFLQGVLASLVASLIVYLNSKLFKKVKSHSGRSDFSFELKIKFKKNKH
Download Length: 153 bp
Antitoxin
Download Length: 101 bp
>AT285470 NZ_LN614756:c1650256-1650156 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTAGACGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTTTAGTTC
AAAACTAAAGTCACTCCTGCC
AAGAAGAACTACAATCTATTTAGACGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTTTAGTTC
AAAACTAAAGTCACTCCTGCC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|