Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
Location | 4523467..4523879 | Replicon | chromosome |
Accession | NZ_LM995446 | ||
Organism | Escherichia coli strain K-12 substr. RV308 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | ECRV308_RS22355 | Protein ID | WP_000132601.1 |
Coordinates | 4523467..4523808 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4523803..4523879 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECRV308_RS22345 | 4520880..4521926 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
ECRV308_RS22350 | 4521926..4523305 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
ECRV308_RS22355 | 4523467..4523808 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
- | 4523803..4523879 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4523803..4523879 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4523803..4523879 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4523803..4523879 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4523803..4523879 | + | 77 | NuclAT_15 | - | Antitoxin |
- | 4523803..4523879 | + | 77 | NuclAT_15 | - | Antitoxin |
- | 4523803..4523879 | + | 77 | NuclAT_15 | - | Antitoxin |
- | 4523803..4523879 | + | 77 | NuclAT_15 | - | Antitoxin |
ECRV308_RS22360 | 4524036..4525430 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
ECRV308_RS22365 | 4525427..4527016 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4516382..4525430 | 9048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T285453 WP_000132601.1 NZ_LM995446:c4523808-4523467 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT285453 NZ_LM995446:4523803-4523879 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|