Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1615306..1615832 | Replicon | chromosome |
| Accession | NZ_LM993812 | ||
| Organism | Escherichia coli strain K-12 substr. HMS174 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | ECHMS174_RS08000 | Protein ID | WP_000323025.1 |
| Coordinates | 1615306..1615593 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | ECHMS174_RS08005 | Protein ID | WP_000534858.1 |
| Coordinates | 1615593..1615832 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECHMS174_RS07960 | 1610330..1610545 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| ECHMS174_RS07965 | 1611299..1611514 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| ECHMS174_RS07970 | 1611815..1612027 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| ECHMS174_RS25355 | 1612082..1612171 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| ECHMS174_RS07975 | 1612449..1613201 | - | 753 | WP_001047135.1 | antitermination protein | - |
| ECHMS174_RS07980 | 1613215..1614264 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
| ECHMS174_RS07985 | 1614266..1614544 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| ECHMS174_RS07990 | 1614611..1614862 | - | 252 | WP_000980994.1 | hypothetical protein | - |
| ECHMS174_RS07995 | 1615079..1615234 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| ECHMS174_RS08000 | 1615306..1615593 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| ECHMS174_RS08005 | 1615593..1615832 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| ECHMS174_RS23530 | 1615857..1616162 | + | 306 | WP_001326990.1 | hypothetical protein | - |
| ECHMS174_RS08010 | 1616365..1616697 | + | 333 | WP_001301033.1 | protein FlxA | - |
| ECHMS174_RS22810 | 1617134..1617283 | - | 150 | WP_011443592.1 | hypothetical protein | - |
| ECHMS174_RS08015 | 1617318..1617596 | - | 279 | Protein_1534 | hypothetical protein | - |
| ECHMS174_RS08020 | 1617580..1617810 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| ECHMS174_RS08025 | 1617894..1618301 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| ECHMS174_RS08030 | 1618468..1618623 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| ECHMS174_RS08035 | 1618783..1619001 | + | 219 | WP_001171942.1 | hypothetical protein | - |
| ECHMS174_RS08045 | 1619569..1619757 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| ECHMS174_RS08050 | 1619754..1619912 | + | 159 | WP_045152978.1 | DUF1482 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1600962..1621216 | 20254 | ||
| - | inside | Prophage | - | - | 1584764..1621216 | 36452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T285399 WP_000323025.1 NZ_LM993812:c1615593-1615306 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|