Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2188746..2189160 Replicon chromosome
Accession NZ_CP127019
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QQO11_RS11055 Protein ID WP_025174939.1
Coordinates 2188909..2189160 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QQO11_RS11050 Protein ID WP_000028424.1
Coordinates 2188746..2188919 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO11_RS10990 (2184785) 2184785..2185252 - 468 WP_000919026.1 phage terminase small subunit P27 family -
QQO11_RS10995 (2185381) 2185381..2185725 - 345 WP_000817289.1 HNH endonuclease -
QQO11_RS11000 (2185741) 2185741..2186193 - 453 WP_000406191.1 nucleoside triphosphate pyrophosphohydrolase family protein -
QQO11_RS11005 (2186308) 2186308..2186778 - 471 WP_000282755.1 hypothetical protein -
QQO11_RS11010 (2186801) 2186801..2187001 - 201 WP_001570807.1 DUF1514 family protein -
QQO11_RS11015 (2187001) 2187001..2187126 - 126 WP_031783376.1 transcriptional regulator -
QQO11_RS11020 (2187119) 2187119..2187322 - 204 WP_001072793.1 hypothetical protein -
QQO11_RS11025 (2187323) 2187323..2187514 - 192 Protein_2138 hypothetical protein -
QQO11_RS11030 (2187511) 2187511..2187717 - 207 WP_000195826.1 DUF1381 domain-containing protein -
QQO11_RS11035 (2187754) 2187754..2188287 - 534 WP_025920701.1 dUTP diphosphatase -
QQO11_RS11040 (2188302) 2188302..2188463 - 162 WP_000889683.1 hypothetical protein -
QQO11_RS11045 (2188464) 2188464..2188745 - 282 WP_000454994.1 hypothetical protein -
QQO11_RS11050 (2188746) 2188746..2188919 - 174 WP_000028424.1 hypothetical protein Antitoxin
QQO11_RS11055 (2188909) 2188909..2189160 - 252 WP_025174939.1 DUF1024 family protein Toxin
QQO11_RS11060 (2189175) 2189175..2189417 - 243 WP_000131381.1 phi PVL orf 51-like protein -
QQO11_RS11065 (2189421) 2189421..2189791 - 371 Protein_2146 SA1788 family PVL leukocidin-associated protein -
QQO11_RS11070 (2189804) 2189804..2190208 - 405 WP_000401978.1 RusA family crossover junction endodeoxyribonuclease -
QQO11_RS11075 (2190217) 2190217..2190435 - 219 WP_000338527.1 hypothetical protein -
QQO11_RS11080 (2190442) 2190442..2191335 - 894 WP_000148335.1 DnaD domain-containing protein -
QQO11_RS11085 (2191365) 2191365..2191835 - 471 WP_000934760.1 single-stranded DNA-binding protein -
QQO11_RS11090 (2191836) 2191836..2192453 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
QQO11_RS11095 (2192534) 2192534..2193454 - 921 WP_000138475.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - scn / sak / sea / hlb / groEL 2160352..2216881 56529


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9361.22 Da        Isoelectric Point: 3.8464

>T283505 WP_025174939.1 NZ_CP127019:c2189160-2188909 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILDGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT283505 WP_000028424.1 NZ_CP127019:c2188919-2188746 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References