Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 2163983..2164248 | Replicon | chromosome |
| Accession | NZ_CP127019 | ||
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | W8TS34 |
| Locus tag | QQO11_RS10885 | Protein ID | WP_000226108.1 |
| Coordinates | 2164114..2164248 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 2163983..2164122 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO11_RS10845 (2159549) | 2159549..2159728 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| QQO11_RS10850 (2160039) | 2160039..2160299 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| QQO11_RS10855 (2160352) | 2160352..2160702 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| QQO11_RS10860 (2161213) | 2161213..2161548 | - | 336 | Protein_2105 | SH3 domain-containing protein | - |
| QQO11_RS10865 (2162199) | 2162199..2162690 | - | 492 | WP_000920038.1 | staphylokinase | - |
| QQO11_RS10870 (2162881) | 2162881..2163636 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| QQO11_RS10875 (2163648) | 2163648..2163902 | - | 255 | WP_000611512.1 | phage holin | - |
| QQO11_RS10880 (2163954) | 2163954..2164061 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - (2163983) | 2163983..2164122 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2163983) | 2163983..2164122 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2163983) | 2163983..2164122 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (2163983) | 2163983..2164122 | + | 140 | NuclAT_0 | - | Antitoxin |
| QQO11_RS10885 (2164114) | 2164114..2164248 | - | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| QQO11_RS10890 (2164399) | 2164399..2165172 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| QQO11_RS10895 (2165545) | 2165545..2165919 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| QQO11_RS10900 (2165975) | 2165975..2166262 | - | 288 | WP_285236782.1 | hypothetical protein | - |
| QQO11_RS10905 (2166308) | 2166308..2166460 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | scn / sak / sea / hlb / groEL | 2160352..2216881 | 56529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 5029.35 Da Isoelectric Point: 11.7213
>T283502 WP_000226108.1 NZ_CP127019:c2164248-2164114 [Staphylococcus aureus]
MVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 135 bp
Antitoxin
Download Length: 140 bp
>AT283502 NZ_CP127019:2163983-2164122 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|