Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1731652..1731872 | Replicon | chromosome |
Accession | NZ_CP126076 | ||
Organism | Clostridioides difficile strain CDI-01 |
Toxin (Protein)
Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
Locus tag | ITJ31_RS08170 | Protein ID | WP_003429855.1 |
Coordinates | 1731652..1731813 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1731733..1731872 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITJ31_RS08140 (ITJ31_008140) | 1727509..1727946 | + | 438 | WP_009888839.1 | hypothetical protein | - |
ITJ31_RS08145 (ITJ31_008145) | 1727939..1728115 | + | 177 | WP_009888840.1 | hypothetical protein | - |
ITJ31_RS08150 (ITJ31_008150) | 1728116..1729426 | + | 1311 | WP_009893136.1 | phage tail sheath family protein | - |
ITJ31_RS08155 (ITJ31_008155) | 1729443..1729913 | + | 471 | WP_009888842.1 | phage tail tube protein | - |
ITJ31_RS08160 (ITJ31_008160) | 1729972..1730799 | + | 828 | WP_009888843.1 | hypothetical protein | - |
ITJ31_RS08165 (ITJ31_008165) | 1730871..1731311 | + | 441 | WP_003429853.1 | phage portal protein | - |
ITJ31_RS08170 (ITJ31_008170) | 1731652..1731813 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
- | 1731733..1731872 | - | 140 | - | - | Antitoxin |
ITJ31_RS08175 (ITJ31_008175) | 1733150..1733338 | + | 189 | WP_003429858.1 | hypothetical protein | - |
ITJ31_RS08180 (ITJ31_008180) | 1733457..1734323 | + | 867 | WP_009888845.1 | BRO family protein | - |
ITJ31_RS08185 (ITJ31_008185) | 1734376..1734510 | + | 135 | WP_009888846.1 | hypothetical protein | - |
ITJ31_RS08190 (ITJ31_008190) | 1735188..1735715 | + | 528 | WP_009888847.1 | DUF4352 domain-containing protein | - |
ITJ31_RS08195 (ITJ31_008195) | 1735853..1736620 | + | 768 | WP_009888848.1 | DUF4428 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1697863..1765000 | 67137 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T282579 WP_003429855.1 NZ_CP126076:1731652-1731813 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 140 bp
>AT282579 NZ_CP126076:c1731872-1731733 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|