Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 2856447..2856656 | Replicon | chromosome |
| Accession | NZ_CP126075 | ||
| Organism | Clostridioides difficile strain CDI-02 | ||
Toxin (Protein)
| Gene name | CD2517.1 | Uniprot ID | Q182K5 |
| Locus tag | ITJ29_RS13580 | Protein ID | WP_004454815.1 |
| Coordinates | 2856498..2856656 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | RCd8 | ||
| Locus tag | - | ||
| Coordinates | 2856447..2856581 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ITJ29_RS13565 (2852338) | 2852338..2853966 | + | 1629 | WP_004454813.1 | aspartate 4-decarboxylase | - |
| ITJ29_RS13570 (2854087) | 2854087..2855082 | + | 996 | WP_003431031.1 | asparaginase | - |
| ITJ29_RS13575 (2855271) | 2855271..2855555 | - | 285 | WP_224213953.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| - (2856447) | 2856447..2856581 | + | 135 | NuclAT_0 | - | Antitoxin |
| - (2856447) | 2856447..2856581 | + | 135 | NuclAT_0 | - | Antitoxin |
| ITJ29_RS13580 (2856498) | 2856498..2856656 | - | 159 | WP_004454815.1 | hypothetical protein | Toxin |
| ITJ29_RS13585 (2857015) | 2857015..2858385 | - | 1371 | WP_021360826.1 | cell wall-binding protein Cwp29 | - |
| ITJ29_RS13590 (2858821) | 2858821..2858907 | + | 87 | WP_231298880.1 | hypothetical protein | - |
| ITJ29_RS13595 (2859437) | 2859437..2859709 | + | 273 | WP_004454820.1 | tyrosine-type recombinase/integrase | - |
| ITJ29_RS13600 (2860083) | 2860083..2860163 | - | 81 | Protein_2605 | VOC family protein | - |
| ITJ29_RS13605 (2860203) | 2860203..2860871 | - | 669 | WP_009897711.1 | VanZ family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5996.20 Da Isoelectric Point: 11.3102
>T282577 WP_004454815.1 NZ_CP126075:c2856656-2856498 [Clostridioides difficile]
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
Download Length: 159 bp
Antitoxin
Download Length: 135 bp
>AT282577 NZ_CP126075:2856447-2856581 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|