Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 2612471..2612673 | Replicon | chromosome |
| Accession | NZ_CP126075 | ||
| Organism | Clostridioides difficile strain CDI-02 | ||
Toxin (Protein)
| Gene name | CD2299.1 | Uniprot ID | Q185H1 |
| Locus tag | ITJ29_RS12465 | Protein ID | WP_004454589.1 |
| Coordinates | 2612521..2612673 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | SQ1641 | ||
| Locus tag | - | ||
| Coordinates | 2612471..2612600 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ITJ29_RS12430 (2607597) | 2607597..2607914 | + | 318 | WP_004454574.1 | hypothetical protein | - |
| ITJ29_RS12435 (2608164) | 2608164..2608514 | + | 351 | WP_021360756.1 | hypothetical protein | - |
| ITJ29_RS12440 (2608843) | 2608843..2609004 | - | 162 | WP_004454578.1 | hypothetical protein | - |
| ITJ29_RS12445 (2609056) | 2609056..2609508 | - | 453 | WP_021360757.1 | hypothetical protein | - |
| ITJ29_RS12450 (2609505) | 2609505..2609870 | - | 366 | WP_021360758.1 | BRO family protein | - |
| ITJ29_RS12455 (2609991) | 2609991..2610179 | - | 189 | WP_004454585.1 | virulence factor Srl | - |
| ITJ29_RS12460 (2611420) | 2611420..2612253 | - | 834 | WP_021360759.1 | SHOCT domain-containing protein | - |
| - (2612471) | 2612471..2612600 | + | 130 | NuclAT_1 | - | Antitoxin |
| - (2612471) | 2612471..2612600 | + | 130 | NuclAT_1 | - | Antitoxin |
| ITJ29_RS12465 (2612521) | 2612521..2612673 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
| ITJ29_RS12470 (2612946) | 2612946..2613269 | - | 324 | WP_009897482.1 | DUF6054 family protein | - |
| ITJ29_RS12475 (2613305) | 2613305..2613559 | - | 255 | WP_004454592.1 | hypothetical protein | - |
| ITJ29_RS12480 (2613999) | 2613999..2614517 | - | 519 | Protein_2382 | RNA-guided endonuclease TnpB family protein | - |
| ITJ29_RS12485 (2614807) | 2614807..2615182 | - | 376 | Protein_2383 | BlaI/MecI/CopY family transcriptional regulator | - |
| ITJ29_RS12490 (2615287) | 2615287..2615664 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| ITJ29_RS12495 (2616468) | 2616468..2616962 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| ITJ29_RS12500 (2617323) | 2617323..2617521 | + | 199 | Protein_2386 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T282575 WP_004454589.1 NZ_CP126075:c2612673-2612521 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
Antitoxin
Download Length: 130 bp
>AT282575 NZ_CP126075:2612471-2612600 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|