Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 2612471..2612673 Replicon chromosome
Accession NZ_CP126075
Organism Clostridioides difficile strain CDI-02

Toxin (Protein)


Gene name CD2299.1 Uniprot ID Q185H1
Locus tag ITJ29_RS12465 Protein ID WP_004454589.1
Coordinates 2612521..2612673 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name SQ1641
Locus tag -
Coordinates 2612471..2612600 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ITJ29_RS12430 (2607597) 2607597..2607914 + 318 WP_004454574.1 hypothetical protein -
ITJ29_RS12435 (2608164) 2608164..2608514 + 351 WP_021360756.1 hypothetical protein -
ITJ29_RS12440 (2608843) 2608843..2609004 - 162 WP_004454578.1 hypothetical protein -
ITJ29_RS12445 (2609056) 2609056..2609508 - 453 WP_021360757.1 hypothetical protein -
ITJ29_RS12450 (2609505) 2609505..2609870 - 366 WP_021360758.1 BRO family protein -
ITJ29_RS12455 (2609991) 2609991..2610179 - 189 WP_004454585.1 virulence factor Srl -
ITJ29_RS12460 (2611420) 2611420..2612253 - 834 WP_021360759.1 SHOCT domain-containing protein -
- (2612471) 2612471..2612600 + 130 NuclAT_1 - Antitoxin
- (2612471) 2612471..2612600 + 130 NuclAT_1 - Antitoxin
ITJ29_RS12465 (2612521) 2612521..2612673 - 153 WP_004454589.1 hypothetical protein Toxin
ITJ29_RS12470 (2612946) 2612946..2613269 - 324 WP_009897482.1 DUF6054 family protein -
ITJ29_RS12475 (2613305) 2613305..2613559 - 255 WP_004454592.1 hypothetical protein -
ITJ29_RS12480 (2613999) 2613999..2614517 - 519 Protein_2382 RNA-guided endonuclease TnpB family protein -
ITJ29_RS12485 (2614807) 2614807..2615182 - 376 Protein_2383 BlaI/MecI/CopY family transcriptional regulator -
ITJ29_RS12490 (2615287) 2615287..2615664 - 378 WP_011861518.1 BlaI/MecI/CopY family transcriptional regulator -
ITJ29_RS12495 (2616468) 2616468..2616962 + 495 WP_011861519.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
ITJ29_RS12500 (2617323) 2617323..2617521 + 199 Protein_2386 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.92 Da        Isoelectric Point: 10.6365

>T282575 WP_004454589.1 NZ_CP126075:c2612673-2612521 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK

Download         Length: 153 bp

Antitoxin


Download         Length: 130 bp

>AT282575 NZ_CP126075:2612471-2612600 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A125V725

Antitoxin

Download structure file

References