Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1525900..1526096 | Replicon | chromosome |
| Accession | NZ_CP126075 | ||
| Organism | Clostridioides difficile strain CDI-02 | ||
Toxin (Protein)
| Gene name | CD1418.2 | Uniprot ID | Q18BT8 |
| Locus tag | ITJ29_RS07205 | Protein ID | WP_009902496.1 |
| Coordinates | 1525900..1526052 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | CD630_n00500 | ||
| Locus tag | - | ||
| Coordinates | 1525996..1526096 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ITJ29_RS07185 (1521439) | 1521439..1521987 | - | 549 | WP_011861206.1 | DUF308 domain-containing protein | - |
| ITJ29_RS07190 (1522139) | 1522139..1522567 | + | 429 | WP_003429356.1 | DMT family transporter | - |
| ITJ29_RS07195 (1522634) | 1522634..1523302 | + | 669 | WP_003429358.1 | diphthine--ammonia ligase | - |
| ITJ29_RS07200 (1523420) | 1523420..1524775 | - | 1356 | WP_003438549.1 | MATE family efflux transporter | - |
| ITJ29_RS07205 (1525900) | 1525900..1526052 | + | 153 | WP_009902496.1 | hypothetical protein | Toxin |
| - (1525996) | 1525996..1526096 | - | 101 | NuclAT_2 | - | Antitoxin |
| - (1525996) | 1525996..1526096 | - | 101 | NuclAT_2 | - | Antitoxin |
| ITJ29_RS07210 (1527146) | 1527146..1528879 | - | 1734 | WP_009896333.1 | sensor domain-containing diguanylate cyclase | - |
| ITJ29_RS07215 (1529119) | 1529119..1529964 | - | 846 | WP_009889222.1 | c-di-GMP diguanylate cyclase DccA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5742.81 Da Isoelectric Point: 10.9178
>T282573 WP_009902496.1 NZ_CP126075:1525900-1526052 [Clostridioides difficile]
MDNFLQGVLASLVASLIVYLNSKLFKKVKSHSGRSDFSFELKIKFKKNKH
MDNFLQGVLASLVASLIVYLNSKLFKKVKSHSGRSDFSFELKIKFKKNKH
Download Length: 153 bp
Antitoxin
Download Length: 101 bp
>AT282573 NZ_CP126075:c1526096-1525996 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTAGATGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTTTAGTTC
AAAACTAAAGTCACTCCTGCC
AAGAAGAACTACAATCTATTTAGATGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTTTAGTTC
AAAACTAAAGTCACTCCTGCC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|