Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 1272477..1272682 Replicon chromosome
Accession NZ_CP126075
Organism Clostridioides difficile strain CDI-02

Toxin (Protein)


Gene name CD1233.1 Uniprot ID A0A069A9H6
Locus tag ITJ29_RS05925 Protein ID WP_009896140.1
Coordinates 1272477..1272629 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name SQ808
Locus tag -
Coordinates 1272609..1272682 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ITJ29_RS05905 (1267939) 1267939..1268223 - 285 WP_003419254.1 sigma-70 family RNA polymerase sigma factor -
ITJ29_RS05910 (1268246) 1268246..1269763 - 1518 WP_021360429.1 recombinase family protein -
ITJ29_RS05915 (1269888) 1269888..1270709 - 822 WP_021360430.1 tetratricopeptide repeat protein -
ITJ29_RS05920 (1270900) 1270900..1272327 + 1428 WP_021361414.1 cell wall-binding protein Cwp26 -
ITJ29_RS05925 (1272477) 1272477..1272629 + 153 WP_009896140.1 hypothetical protein Toxin
- (1272609) 1272609..1272682 - 74 NuclAT_3 - Antitoxin
- (1272609) 1272609..1272682 - 74 NuclAT_3 - Antitoxin
ITJ29_RS05930 (1273509) 1273509..1273724 - 216 WP_021360433.1 helix-turn-helix transcriptional regulator -
ITJ29_RS05935 (1274895) 1274895..1275050 + 156 WP_021360434.1 hypothetical protein -
ITJ29_RS05940 (1275069) 1275069..1275425 - 357 WP_021360435.1 helix-turn-helix transcriptional regulator -
ITJ29_RS05945 (1275588) 1275588..1275773 + 186 WP_021360436.1 hypothetical protein -
ITJ29_RS05950 (1275893) 1275893..1276633 + 741 WP_021360437.1 Bro-N domain-containing protein -
ITJ29_RS05955 (1276690) 1276690..1277283 + 594 WP_021360438.1 hypothetical protein -
ITJ29_RS05960 (1277352) 1277352..1277570 + 219 WP_009894510.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5811.96 Da        Isoelectric Point: 11.1039

>T282571 WP_009896140.1 NZ_CP126075:1272477-1272629 [Clostridioides difficile]
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK

Download         Length: 153 bp

Antitoxin


Download         Length: 74 bp

>AT282571 NZ_CP126075:c1272682-1272609 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A069A9H6

Antitoxin

Download structure file

References