Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1272477..1272682 | Replicon | chromosome |
Accession | NZ_CP126075 | ||
Organism | Clostridioides difficile strain CDI-02 |
Toxin (Protein)
Gene name | CD1233.1 | Uniprot ID | A0A069A9H6 |
Locus tag | ITJ29_RS05925 | Protein ID | WP_009896140.1 |
Coordinates | 1272477..1272629 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ808 | ||
Locus tag | - | ||
Coordinates | 1272609..1272682 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITJ29_RS05905 (1267939) | 1267939..1268223 | - | 285 | WP_003419254.1 | sigma-70 family RNA polymerase sigma factor | - |
ITJ29_RS05910 (1268246) | 1268246..1269763 | - | 1518 | WP_021360429.1 | recombinase family protein | - |
ITJ29_RS05915 (1269888) | 1269888..1270709 | - | 822 | WP_021360430.1 | tetratricopeptide repeat protein | - |
ITJ29_RS05920 (1270900) | 1270900..1272327 | + | 1428 | WP_021361414.1 | cell wall-binding protein Cwp26 | - |
ITJ29_RS05925 (1272477) | 1272477..1272629 | + | 153 | WP_009896140.1 | hypothetical protein | Toxin |
- (1272609) | 1272609..1272682 | - | 74 | NuclAT_3 | - | Antitoxin |
- (1272609) | 1272609..1272682 | - | 74 | NuclAT_3 | - | Antitoxin |
ITJ29_RS05930 (1273509) | 1273509..1273724 | - | 216 | WP_021360433.1 | helix-turn-helix transcriptional regulator | - |
ITJ29_RS05935 (1274895) | 1274895..1275050 | + | 156 | WP_021360434.1 | hypothetical protein | - |
ITJ29_RS05940 (1275069) | 1275069..1275425 | - | 357 | WP_021360435.1 | helix-turn-helix transcriptional regulator | - |
ITJ29_RS05945 (1275588) | 1275588..1275773 | + | 186 | WP_021360436.1 | hypothetical protein | - |
ITJ29_RS05950 (1275893) | 1275893..1276633 | + | 741 | WP_021360437.1 | Bro-N domain-containing protein | - |
ITJ29_RS05955 (1276690) | 1276690..1277283 | + | 594 | WP_021360438.1 | hypothetical protein | - |
ITJ29_RS05960 (1277352) | 1277352..1277570 | + | 219 | WP_009894510.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5811.96 Da Isoelectric Point: 11.1039
>T282571 WP_009896140.1 NZ_CP126075:1272477-1272629 [Clostridioides difficile]
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
Download Length: 153 bp
Antitoxin
Download Length: 74 bp
>AT282571 NZ_CP126075:c1272682-1272609 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|