Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2764433..2764642 | Replicon | chromosome |
Accession | NZ_CP126072 | ||
Organism | Clostridioides difficile strain CDI-22 |
Toxin (Protein)
Gene name | CD2517.1 | Uniprot ID | Q182K5 |
Locus tag | ITI92_RS12895 | Protein ID | WP_004454815.1 |
Coordinates | 2764484..2764642 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 2764433..2764567 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI92_RS12880 (2759461) | 2759461..2761089 | + | 1629 | WP_004454813.1 | aspartate 4-decarboxylase | - |
ITI92_RS12885 (2761210) | 2761210..2762205 | + | 996 | WP_003431031.1 | asparaginase | - |
ITI92_RS12890 (2762394) | 2762394..2762678 | - | 285 | WP_224213953.1 | BlaI/MecI/CopY family transcriptional regulator | - |
- (2764433) | 2764433..2764567 | + | 135 | NuclAT_0 | - | Antitoxin |
- (2764433) | 2764433..2764567 | + | 135 | NuclAT_0 | - | Antitoxin |
ITI92_RS12895 (2764484) | 2764484..2764642 | - | 159 | WP_004454815.1 | hypothetical protein | Toxin |
ITI92_RS12900 (2765001) | 2765001..2766371 | - | 1371 | WP_009897709.1 | cell wall-binding protein Cwp29 | - |
ITI92_RS12905 (2766807) | 2766807..2766893 | + | 87 | WP_231298880.1 | hypothetical protein | - |
ITI92_RS12910 (2766937) | 2766937..2767236 | - | 300 | WP_225722727.1 | hypothetical protein | - |
ITI92_RS12915 (2767423) | 2767423..2767695 | + | 273 | WP_004454820.1 | tyrosine-type recombinase/integrase | - |
ITI92_RS12920 (2768013) | 2768013..2768681 | - | 669 | WP_009897711.1 | VanZ family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5996.20 Da Isoelectric Point: 11.3102
>T282569 WP_004454815.1 NZ_CP126072:c2764642-2764484 [Clostridioides difficile]
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
Download Length: 159 bp
Antitoxin
Download Length: 135 bp
>AT282569 NZ_CP126072:2764433-2764567 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|