Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 2517481..2517683 Replicon chromosome
Accession NZ_CP126072
Organism Clostridioides difficile strain CDI-22

Toxin (Protein)


Gene name CD2299.1 Uniprot ID Q185H1
Locus tag ITI92_RS11765 Protein ID WP_004454589.1
Coordinates 2517531..2517683 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name SQ1641
Locus tag -
Coordinates 2517481..2517610 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ITI92_RS11725 (2512591) 2512591..2512908 + 318 WP_009897465.1 hypothetical protein -
ITI92_RS11730 (2513044) 2513044..2513508 + 465 WP_004454576.1 hypothetical protein -
ITI92_RS11735 (2513537) 2513537..2513707 - 171 Protein_2233 cell wall-binding repeat-containing protein -
ITI92_RS11740 (2513837) 2513837..2513998 - 162 WP_004454578.1 hypothetical protein -
ITI92_RS11745 (2514050) 2514050..2514502 - 453 WP_021359435.1 hypothetical protein -
ITI92_RS11750 (2514499) 2514499..2514864 - 366 WP_016729316.1 Bro-N domain-containing protein -
ITI92_RS11755 (2514984) 2514984..2515172 - 189 WP_004454585.1 virulence factor Srl -
ITI92_RS11760 (2516453) 2516453..2517262 - 810 WP_018112791.1 hypothetical protein -
- (2517481) 2517481..2517610 + 130 NuclAT_2 - Antitoxin
- (2517481) 2517481..2517610 + 130 NuclAT_3 - Antitoxin
ITI92_RS11765 (2517531) 2517531..2517683 - 153 WP_004454589.1 hypothetical protein Toxin
ITI92_RS11770 (2517957) 2517957..2518280 - 324 WP_009897482.1 DUF6054 family protein -
ITI92_RS11775 (2518316) 2518316..2518570 - 255 WP_004454592.1 hypothetical protein -
ITI92_RS11780 (2519002) 2519002..2519520 - 519 Protein_2242 RNA-guided endonuclease TnpB family protein -
ITI92_RS11785 (2519810) 2519810..2520184 - 375 Protein_2243 BlaI/MecI/CopY family transcriptional regulator -
ITI92_RS11790 (2520289) 2520289..2520663 - 375 WP_004454597.1 BlaI/MecI/CopY family transcriptional regulator -
ITI92_RS11795 (2521467) 2521467..2521955 + 489 WP_004454599.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
ITI92_RS11800 (2522316) 2522316..2522514 + 199 Protein_2246 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.92 Da        Isoelectric Point: 10.6365

>T282567 WP_004454589.1 NZ_CP126072:c2517683-2517531 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK

Download         Length: 153 bp

Antitoxin


Download         Length: 130 bp

>AT282567 NZ_CP126072:2517481-2517610 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A125V725

Antitoxin

Download structure file

References