Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 2517481..2517683 | Replicon | chromosome |
| Accession | NZ_CP126072 | ||
| Organism | Clostridioides difficile strain CDI-22 | ||
Toxin (Protein)
| Gene name | CD2299.1 | Uniprot ID | Q185H1 |
| Locus tag | ITI92_RS11765 | Protein ID | WP_004454589.1 |
| Coordinates | 2517531..2517683 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | SQ1641 | ||
| Locus tag | - | ||
| Coordinates | 2517481..2517610 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ITI92_RS11725 (2512591) | 2512591..2512908 | + | 318 | WP_009897465.1 | hypothetical protein | - |
| ITI92_RS11730 (2513044) | 2513044..2513508 | + | 465 | WP_004454576.1 | hypothetical protein | - |
| ITI92_RS11735 (2513537) | 2513537..2513707 | - | 171 | Protein_2233 | cell wall-binding repeat-containing protein | - |
| ITI92_RS11740 (2513837) | 2513837..2513998 | - | 162 | WP_004454578.1 | hypothetical protein | - |
| ITI92_RS11745 (2514050) | 2514050..2514502 | - | 453 | WP_021359435.1 | hypothetical protein | - |
| ITI92_RS11750 (2514499) | 2514499..2514864 | - | 366 | WP_016729316.1 | Bro-N domain-containing protein | - |
| ITI92_RS11755 (2514984) | 2514984..2515172 | - | 189 | WP_004454585.1 | virulence factor Srl | - |
| ITI92_RS11760 (2516453) | 2516453..2517262 | - | 810 | WP_018112791.1 | hypothetical protein | - |
| - (2517481) | 2517481..2517610 | + | 130 | NuclAT_2 | - | Antitoxin |
| - (2517481) | 2517481..2517610 | + | 130 | NuclAT_3 | - | Antitoxin |
| ITI92_RS11765 (2517531) | 2517531..2517683 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
| ITI92_RS11770 (2517957) | 2517957..2518280 | - | 324 | WP_009897482.1 | DUF6054 family protein | - |
| ITI92_RS11775 (2518316) | 2518316..2518570 | - | 255 | WP_004454592.1 | hypothetical protein | - |
| ITI92_RS11780 (2519002) | 2519002..2519520 | - | 519 | Protein_2242 | RNA-guided endonuclease TnpB family protein | - |
| ITI92_RS11785 (2519810) | 2519810..2520184 | - | 375 | Protein_2243 | BlaI/MecI/CopY family transcriptional regulator | - |
| ITI92_RS11790 (2520289) | 2520289..2520663 | - | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| ITI92_RS11795 (2521467) | 2521467..2521955 | + | 489 | WP_004454599.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| ITI92_RS11800 (2522316) | 2522316..2522514 | + | 199 | Protein_2246 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T282567 WP_004454589.1 NZ_CP126072:c2517683-2517531 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
Antitoxin
Download Length: 130 bp
>AT282567 NZ_CP126072:2517481-2517610 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
