Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1692914..1693128 | Replicon | chromosome |
Accession | NZ_CP126072 | ||
Organism | Clostridioides difficile strain CDI-22 |
Toxin (Protein)
Gene name | CD0956.2 | Uniprot ID | - |
Locus tag | ITI92_RS07925 | Protein ID | WP_032508407.1 |
Coordinates | 1692914..1693075 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1692995..1693128 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI92_RS07885 (1688102) | 1688102..1688392 | + | 291 | WP_021358995.1 | HK97 gp10 family phage protein | - |
ITI92_RS07890 (1688502) | 1688502..1689308 | + | 807 | WP_021358994.1 | hypothetical protein | - |
ITI92_RS07895 (1689657) | 1689657..1689782 | + | 126 | WP_021358993.1 | hypothetical protein | - |
ITI92_RS07900 (1689761) | 1689761..1690093 | + | 333 | WP_021358992.1 | hypothetical protein | - |
ITI92_RS07905 (1690086) | 1690086..1690262 | + | 177 | WP_021358991.1 | hypothetical protein | - |
ITI92_RS07910 (1690264) | 1690264..1691574 | + | 1311 | WP_021358990.1 | phage tail sheath family protein | - |
ITI92_RS07915 (1691591) | 1691591..1692061 | + | 471 | WP_003429851.1 | phage tail tube protein | - |
ITI92_RS07920 (1692133) | 1692133..1692573 | + | 441 | WP_003429853.1 | phage portal protein | - |
ITI92_RS07925 (1692914) | 1692914..1693075 | + | 162 | WP_032508407.1 | hypothetical protein | Toxin |
- (1692995) | 1692995..1693128 | - | 134 | NuclAT_1 | - | Antitoxin |
- (1692995) | 1692995..1693128 | - | 134 | NuclAT_1 | - | Antitoxin |
- (1692995) | 1692995..1693128 | - | 134 | NuclAT_2 | - | Antitoxin |
- (1693473) | 1693473..1693521 | - | 49 | NuclAT_5 | - | - |
- (1693473) | 1693473..1693521 | - | 49 | NuclAT_6 | - | - |
- (1693473) | 1693473..1693521 | - | 49 | NuclAT_8 | - | - |
- (1694500) | 1694500..1694605 | - | 106 | NuclAT_4 | - | - |
- (1694500) | 1694500..1694605 | - | 106 | NuclAT_5 | - | - |
- (1694500) | 1694500..1694605 | - | 106 | NuclAT_7 | - | - |
ITI92_RS07930 (1695068) | 1695068..1695208 | + | 141 | WP_284183820.1 | hypothetical protein | - |
ITI92_RS07935 (1695456) | 1695456..1696016 | + | 561 | WP_021359010.1 | phage lipoprotein | - |
ITI92_RS07940 (1696059) | 1696059..1696628 | + | 570 | WP_021359011.1 | zinc ribbon domain protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T282564 WP_032508407.1 NZ_CP126072:1692914-1693075 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCIICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCIICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 134 bp
>AT282564 NZ_CP126072:c1693128-1692995 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTTGCGGTAGAGTGAAGTTCATAATTAAATGAATCTATTTGAACTTATGGAACTTGATTTT
AAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|