Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1491947..1492143 | Replicon | chromosome |
Accession | NZ_CP126072 | ||
Organism | Clostridioides difficile strain CDI-22 |
Toxin (Protein)
Gene name | CD1418.2 | Uniprot ID | Q18BT8 |
Locus tag | ITI92_RS06930 | Protein ID | WP_009902496.1 |
Coordinates | 1491947..1492099 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | CD630_n00500 | ||
Locus tag | - | ||
Coordinates | 1492043..1492143 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI92_RS06910 (1487486) | 1487486..1488034 | - | 549 | WP_011861206.1 | DUF308 domain-containing protein | - |
ITI92_RS06915 (1488186) | 1488186..1488614 | + | 429 | WP_003429356.1 | DMT family transporter | - |
ITI92_RS06920 (1488681) | 1488681..1489349 | + | 669 | WP_003429358.1 | diphthine--ammonia ligase | - |
ITI92_RS06925 (1489467) | 1489467..1490822 | - | 1356 | WP_021359142.1 | MATE family efflux transporter | - |
ITI92_RS06930 (1491947) | 1491947..1492099 | + | 153 | WP_009902496.1 | hypothetical protein | Toxin |
- (1492043) | 1492043..1492143 | - | 101 | NuclAT_3 | - | Antitoxin |
- (1492043) | 1492043..1492143 | - | 101 | NuclAT_4 | - | Antitoxin |
ITI92_RS06935 (1493984) | 1493984..1495717 | - | 1734 | WP_021359145.1 | sensor domain-containing diguanylate cyclase | - |
ITI92_RS06940 (1495957) | 1495957..1496802 | - | 846 | WP_009889222.1 | c-di-GMP diguanylate cyclase DccA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5742.81 Da Isoelectric Point: 10.9178
>T282562 WP_009902496.1 NZ_CP126072:1491947-1492099 [Clostridioides difficile]
MDNFLQGVLASLVASLIVYLNSKLFKKVKSHSGRSDFSFELKIKFKKNKH
MDNFLQGVLASLVASLIVYLNSKLFKKVKSHSGRSDFSFELKIKFKKNKH
Download Length: 153 bp
Antitoxin
Download Length: 101 bp
>AT282562 NZ_CP126072:c1492143-1492043 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTAGATGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTTTAGTTC
AAAACTAAAGTCACTCCTGCC
AAGAAGAACTACAATCTATTTAGATGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTTTAGTTC
AAAACTAAAGTCACTCCTGCC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|