Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2821587..2821796 | Replicon | chromosome |
Accession | NZ_CP126071 | ||
Organism | Clostridioides difficile strain CDI-23 |
Toxin (Protein)
Gene name | CD2517.1 | Uniprot ID | Q182K5 |
Locus tag | ITI96_RS13075 | Protein ID | WP_004454815.1 |
Coordinates | 2821638..2821796 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 2821587..2821721 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI96_RS13060 (2817024) | 2817024..2818652 | + | 1629 | WP_004454813.1 | aspartate 4-decarboxylase | - |
ITI96_RS13065 (2818773) | 2818773..2819768 | + | 996 | WP_003431031.1 | asparaginase | - |
ITI96_RS13070 (2819946) | 2819946..2820254 | - | 309 | WP_225532604.1 | BlaI/MecI/CopY family transcriptional regulator | - |
- (2821587) | 2821587..2821721 | + | 135 | NuclAT_0 | - | Antitoxin |
- (2821587) | 2821587..2821721 | + | 135 | NuclAT_0 | - | Antitoxin |
ITI96_RS13075 (2821638) | 2821638..2821796 | - | 159 | WP_004454815.1 | hypothetical protein | Toxin |
ITI96_RS13080 (2822090) | 2822090..2823460 | - | 1371 | WP_021373596.1 | cell wall-binding protein Cwp29 | - |
ITI96_RS13085 (2823676) | 2823676..2824491 | + | 816 | WP_004454819.1 | Arm DNA-binding domain-containing protein | - |
ITI96_RS13090 (2824521) | 2824521..2824793 | + | 273 | WP_004454820.1 | tyrosine-type recombinase/integrase | - |
ITI96_RS13095 (2825156) | 2825156..2825236 | - | 81 | Protein_2504 | VOC family protein | - |
ITI96_RS13100 (2825276) | 2825276..2825944 | - | 669 | WP_021361938.1 | VanZ family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5996.20 Da Isoelectric Point: 11.3102
>T282560 WP_004454815.1 NZ_CP126071:c2821796-2821638 [Clostridioides difficile]
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
Download Length: 159 bp
Antitoxin
Download Length: 135 bp
>AT282560 NZ_CP126071:2821587-2821721 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|