Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 2579018..2579220 Replicon chromosome
Accession NZ_CP126071
Organism Clostridioides difficile strain CDI-23

Toxin (Protein)


Gene name CD2299.1 Uniprot ID Q185H1
Locus tag ITI96_RS11970 Protein ID WP_004454589.1
Coordinates 2579068..2579220 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name SQ1641
Locus tag -
Coordinates 2579018..2579147 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ITI96_RS11935 (2574387) 2574387..2574851 + 465 WP_004454576.1 hypothetical protein -
ITI96_RS11940 (2574880) 2574880..2575050 - 171 Protein_2274 cell wall-binding repeat-containing protein -
ITI96_RS11945 (2575180) 2575180..2575341 - 162 WP_004454578.1 hypothetical protein -
ITI96_RS11950 (2575537) 2575537..2575788 - 252 WP_004454580.1 hypothetical protein -
ITI96_RS11955 (2575841) 2575841..2576206 - 366 WP_004454581.1 Bro-N domain-containing protein -
ITI96_RS11960 (2576327) 2576327..2576515 - 189 WP_004454585.1 virulence factor Srl -
ITI96_RS11965 (2577951) 2577951..2578874 - 924 WP_004454587.1 SHOCT domain-containing protein -
- (2579018) 2579018..2579147 + 130 NuclAT_1 - Antitoxin
- (2579018) 2579018..2579147 + 130 NuclAT_1 - Antitoxin
ITI96_RS11970 (2579068) 2579068..2579220 - 153 WP_004454589.1 hypothetical protein Toxin
ITI96_RS11975 (2579494) 2579494..2579817 - 324 WP_009897482.1 DUF6054 family protein -
ITI96_RS11980 (2579853) 2579853..2580107 - 255 WP_004454592.1 hypothetical protein -
ITI96_RS11985 (2580539) 2580539..2581057 - 519 Protein_2283 RNA-guided endonuclease TnpB family protein -
ITI96_RS11990 (2581347) 2581347..2581721 - 375 Protein_2284 BlaI/MecI/CopY family transcriptional regulator -
ITI96_RS11995 (2581826) 2581826..2582200 - 375 WP_004454597.1 BlaI/MecI/CopY family transcriptional regulator -
ITI96_RS12000 (2583006) 2583006..2583494 + 489 WP_004454599.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
ITI96_RS12005 (2583855) 2583855..2584053 + 199 Protein_2287 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.92 Da        Isoelectric Point: 10.6365

>T282558 WP_004454589.1 NZ_CP126071:c2579220-2579068 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK

Download         Length: 153 bp

Antitoxin


Download         Length: 130 bp

>AT282558 NZ_CP126071:2579018-2579147 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A125V725

Antitoxin

Download structure file

References