Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 3704885..3705100 | Replicon | chromosome |
Accession | NZ_CP126068 | ||
Organism | Clostridioides difficile strain CDI-24 |
Toxin (Protein)
Gene name | CD0977.1 | Uniprot ID | Q18AH6 |
Locus tag | ITI97_RS16945 | Protein ID | WP_011861054.1 |
Coordinates | 3704957..3705100 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 3704885..3705031 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI97_RS16915 (3700108) | 3700108..3700932 | - | 825 | WP_003432350.1 | phosphate ABC transporter permease PstA | - |
ITI97_RS16920 (3700934) | 3700934..3701851 | - | 918 | WP_021361136.1 | phosphate ABC transporter permease subunit PstC | - |
ITI97_RS16925 (3702232) | 3702232..3702705 | - | 474 | WP_022620508.1 | hypothetical protein | - |
ITI97_RS16930 (3703401) | 3703401..3703787 | - | 387 | WP_021366416.1 | BlaI/MecI/CopY family transcriptional regulator | - |
ITI97_RS16935 (3703827) | 3703827..3704129 | - | 303 | Protein_3267 | BlaI/MecI/CopY family transcriptional regulator | - |
ITI97_RS16940 (3704576) | 3704576..3704752 | + | 177 | WP_021358767.1 | hypothetical protein | - |
- (3704885) | 3704885..3705031 | + | 147 | NuclAT_1 | - | Antitoxin |
- (3704885) | 3704885..3705035 | + | 151 | NuclAT_0 | - | - |
- (3704885) | 3704885..3705035 | + | 151 | NuclAT_0 | - | - |
ITI97_RS16945 (3704957) | 3704957..3705100 | - | 144 | WP_011861054.1 | hypothetical protein | Toxin |
ITI97_RS16950 (3705361) | 3705361..3705549 | + | 189 | WP_009898401.1 | hypothetical protein | - |
ITI97_RS16955 (3706250) | 3706250..3706771 | + | 522 | WP_009898403.1 | ImmA/IrrE family metallo-endopeptidase | - |
ITI97_RS16960 (3706747) | 3706747..3708333 | + | 1587 | WP_015984865.1 | hypothetical protein | - |
ITI97_RS16965 (3708397) | 3708397..3708915 | - | 519 | WP_009898407.1 | DUF5706 domain-containing protein | - |
ITI97_RS16970 (3709081) | 3709081..3709428 | - | 348 | WP_284180549.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5337.27 Da Isoelectric Point: 10.5719
>T282555 WP_011861054.1 NZ_CP126068:c3705100-3704957 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
Download Length: 144 bp
Antitoxin
Download Length: 147 bp
>AT282555 NZ_CP126068:3704885-3705031 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|