Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2824052..2824261 | Replicon | chromosome |
Accession | NZ_CP126068 | ||
Organism | Clostridioides difficile strain CDI-24 |
Toxin (Protein)
Gene name | CD2517.1 | Uniprot ID | Q182K5 |
Locus tag | ITI97_RS13345 | Protein ID | WP_004454815.1 |
Coordinates | 2824103..2824261 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 2824052..2824186 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI97_RS13330 (2819679) | 2819679..2821307 | + | 1629 | WP_004454813.1 | aspartate 4-decarboxylase | - |
ITI97_RS13335 (2821428) | 2821428..2822423 | + | 996 | WP_003431031.1 | asparaginase | - |
ITI97_RS13340 (2822612) | 2822612..2822896 | - | 285 | WP_224213953.1 | BlaI/MecI/CopY family transcriptional regulator | - |
- (2824052) | 2824052..2824186 | + | 135 | NuclAT_1 | - | Antitoxin |
- (2824052) | 2824052..2824186 | + | 135 | NuclAT_2 | - | Antitoxin |
ITI97_RS13345 (2824103) | 2824103..2824261 | - | 159 | WP_004454815.1 | hypothetical protein | Toxin |
ITI97_RS13350 (2824620) | 2824620..2825990 | - | 1371 | WP_009897709.1 | cell wall-binding protein Cwp29 | - |
ITI97_RS13355 (2826426) | 2826426..2826512 | + | 87 | WP_231298880.1 | hypothetical protein | - |
ITI97_RS13360 (2826556) | 2826556..2826855 | - | 300 | WP_231301800.1 | hypothetical protein | - |
ITI97_RS13365 (2827042) | 2827042..2827314 | + | 273 | WP_004454820.1 | tyrosine-type recombinase/integrase | - |
ITI97_RS13370 (2827632) | 2827632..2828300 | - | 669 | WP_009897711.1 | VanZ family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5996.20 Da Isoelectric Point: 11.3102
>T282553 WP_004454815.1 NZ_CP126068:c2824261-2824103 [Clostridioides difficile]
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
Download Length: 159 bp
Antitoxin
Download Length: 135 bp
>AT282553 NZ_CP126068:2824052-2824186 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|