Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 2579917..2580119 Replicon chromosome
Accession NZ_CP126068
Organism Clostridioides difficile strain CDI-24

Toxin (Protein)


Gene name CD2299.1 Uniprot ID Q185H1
Locus tag ITI97_RS12225 Protein ID WP_004454589.1
Coordinates 2579967..2580119 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name SQ1641
Locus tag -
Coordinates 2579917..2580046 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ITI97_RS12185 (2575166) 2575166..2575483 + 318 WP_009897465.1 hypothetical protein -
ITI97_RS12190 (2575619) 2575619..2576083 + 465 WP_004454576.1 hypothetical protein -
ITI97_RS12195 (2576112) 2576112..2576282 - 171 Protein_2325 cell wall-binding repeat-containing protein -
ITI97_RS12200 (2576412) 2576412..2576573 - 162 WP_004454578.1 hypothetical protein -
ITI97_RS12205 (2576625) 2576625..2577077 - 453 WP_009897470.1 hypothetical protein -
ITI97_RS12210 (2577074) 2577074..2577439 - 366 WP_009897471.1 Bro-N domain-containing protein -
ITI97_RS12215 (2577559) 2577559..2577747 - 189 WP_004454585.1 virulence factor Srl -
ITI97_RS12220 (2578850) 2578850..2579773 - 924 WP_021364626.1 SHOCT domain-containing protein -
- (2579917) 2579917..2580046 + 130 NuclAT_2 - Antitoxin
- (2579917) 2579917..2580046 + 130 NuclAT_3 - Antitoxin
ITI97_RS12225 (2579967) 2579967..2580119 - 153 WP_004454589.1 hypothetical protein Toxin
ITI97_RS12230 (2580393) 2580393..2580716 - 324 WP_021364628.1 DUF6054 family protein -
ITI97_RS12235 (2580752) 2580752..2581006 - 255 WP_004454592.1 hypothetical protein -
ITI97_RS12240 (2581438) 2581438..2581956 - 519 Protein_2334 RNA-guided endonuclease TnpB family protein -
ITI97_RS12245 (2582429) 2582429..2582620 - 192 WP_021364351.1 BlaI/MecI/CopY family transcriptional regulator -
ITI97_RS12250 (2582725) 2582725..2583102 - 378 WP_021364350.1 BlaI/MecI/CopY family transcriptional regulator -
ITI97_RS12255 (2583907) 2583907..2584401 + 495 WP_021364347.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
ITI97_RS12260 (2584762) 2584762..2584960 + 199 Protein_2338 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.92 Da        Isoelectric Point: 10.6365

>T282551 WP_004454589.1 NZ_CP126068:c2580119-2579967 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK

Download         Length: 153 bp

Antitoxin


Download         Length: 130 bp

>AT282551 NZ_CP126068:2579917-2580046 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A125V725

Antitoxin

Download structure file

References