Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1327537..1327742 | Replicon | chromosome |
| Accession | NZ_CP126068 | ||
| Organism | Clostridioides difficile strain CDI-24 | ||
Toxin (Protein)
| Gene name | CD1233.1 | Uniprot ID | A0A069A9H6 |
| Locus tag | ITI97_RS06335 | Protein ID | WP_009896140.1 |
| Coordinates | 1327537..1327689 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | SQ808 | ||
| Locus tag | - | ||
| Coordinates | 1327669..1327742 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ITI97_RS06315 (1323477) | 1323477..1323761 | - | 285 | WP_003419254.1 | sigma-70 family RNA polymerase sigma factor | - |
| ITI97_RS06320 (1323784) | 1323784..1325301 | - | 1518 | WP_003438169.1 | recombinase family protein | - |
| ITI97_RS06325 (1325426) | 1325426..1326247 | - | 822 | WP_021367693.1 | tetratricopeptide repeat protein | - |
| ITI97_RS06330 (1326438) | 1326438..1327465 | + | 1028 | Protein_1153 | cell wall-binding protein Cwp26 | - |
| ITI97_RS06335 (1327537) | 1327537..1327689 | + | 153 | WP_009896140.1 | hypothetical protein | Toxin |
| - (1327669) | 1327669..1327742 | - | 74 | NuclAT_4 | - | Antitoxin |
| - (1327669) | 1327669..1327742 | - | 74 | NuclAT_5 | - | Antitoxin |
| ITI97_RS06340 (1329778) | 1329778..1330002 | - | 225 | WP_021367699.1 | helix-turn-helix transcriptional regulator | - |
| ITI97_RS06345 (1330681) | 1330681..1330836 | + | 156 | WP_021363414.1 | hypothetical protein | - |
| ITI97_RS06350 (1331115) | 1331115..1331333 | + | 219 | WP_009889000.1 | hypothetical protein | - |
| ITI97_RS06355 (1331990) | 1331990..1332184 | + | 195 | WP_021367700.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5811.96 Da Isoelectric Point: 11.1039
>T282550 WP_009896140.1 NZ_CP126068:1327537-1327689 [Clostridioides difficile]
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
Download Length: 153 bp
Antitoxin
Download Length: 74 bp
>AT282550 NZ_CP126068:c1327742-1327669 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|