Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2775688..2775897 | Replicon | chromosome |
Accession | NZ_CP126067 | ||
Organism | Clostridioides difficile strain CDI-30 |
Toxin (Protein)
Gene name | CD2517.1 | Uniprot ID | Q182K5 |
Locus tag | ITI90_RS13085 | Protein ID | WP_004454815.1 |
Coordinates | 2775739..2775897 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 2775688..2775822 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI90_RS13070 (2771315) | 2771315..2772943 | + | 1629 | WP_004454813.1 | aspartate 4-decarboxylase | - |
ITI90_RS13075 (2773064) | 2773064..2774059 | + | 996 | WP_003431031.1 | asparaginase | - |
ITI90_RS13080 (2774248) | 2774248..2774532 | - | 285 | WP_224213953.1 | BlaI/MecI/CopY family transcriptional regulator | - |
- (2775688) | 2775688..2775822 | + | 135 | NuclAT_1 | - | Antitoxin |
- (2775688) | 2775688..2775822 | + | 135 | NuclAT_2 | - | Antitoxin |
ITI90_RS13085 (2775739) | 2775739..2775897 | - | 159 | WP_004454815.1 | hypothetical protein | Toxin |
ITI90_RS13090 (2776256) | 2776256..2777626 | - | 1371 | WP_009897709.1 | cell wall-binding protein Cwp29 | - |
ITI90_RS13095 (2778062) | 2778062..2778148 | + | 87 | WP_231298880.1 | hypothetical protein | - |
ITI90_RS13100 (2778192) | 2778192..2778491 | - | 300 | WP_231301800.1 | hypothetical protein | - |
ITI90_RS13105 (2778678) | 2778678..2778950 | + | 273 | WP_004454820.1 | tyrosine-type recombinase/integrase | - |
ITI90_RS13110 (2779268) | 2779268..2779936 | - | 669 | WP_009897711.1 | VanZ family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5996.20 Da Isoelectric Point: 11.3102
>T282548 WP_004454815.1 NZ_CP126067:c2775897-2775739 [Clostridioides difficile]
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
MDNFLQGILASLSASLIVYIASKLFRKRKKPLKAATKSGWEFDLKIRFHKTK
Download Length: 159 bp
Antitoxin
Download Length: 135 bp
>AT282548 NZ_CP126067:2775688-2775822 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
AAGAAGAACTACAATCTATTTTGCTGTAGAGTGGAGTTCATAATTTAGAAATTACTTAGTTTTATGGAATCTGATTTTTA
AATCAAATTCCCAACCACTCTTAGTTGCCGCTTTGAGTGGTTTTTTACGCTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|