Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 2531555..2531757 | Replicon | chromosome |
| Accession | NZ_CP126067 | ||
| Organism | Clostridioides difficile strain CDI-30 | ||
Toxin (Protein)
| Gene name | CD2299.1 | Uniprot ID | Q185H1 |
| Locus tag | ITI90_RS11965 | Protein ID | WP_004454589.1 |
| Coordinates | 2531605..2531757 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | SQ1641 | ||
| Locus tag | - | ||
| Coordinates | 2531555..2531684 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ITI90_RS11925 (2526804) | 2526804..2527121 | + | 318 | WP_009897465.1 | hypothetical protein | - |
| ITI90_RS11930 (2527257) | 2527257..2527721 | + | 465 | WP_004454576.1 | hypothetical protein | - |
| ITI90_RS11935 (2527750) | 2527750..2527920 | - | 171 | Protein_2272 | cell wall-binding repeat-containing protein | - |
| ITI90_RS11940 (2528050) | 2528050..2528211 | - | 162 | WP_004454578.1 | hypothetical protein | - |
| ITI90_RS11945 (2528263) | 2528263..2528715 | - | 453 | WP_009897470.1 | hypothetical protein | - |
| ITI90_RS11950 (2528712) | 2528712..2529077 | - | 366 | WP_009897471.1 | Bro-N domain-containing protein | - |
| ITI90_RS11955 (2529197) | 2529197..2529385 | - | 189 | WP_004454585.1 | virulence factor Srl | - |
| ITI90_RS11960 (2530488) | 2530488..2531411 | - | 924 | WP_021364626.1 | SHOCT domain-containing protein | - |
| - (2531555) | 2531555..2531684 | + | 130 | NuclAT_2 | - | Antitoxin |
| - (2531555) | 2531555..2531684 | + | 130 | NuclAT_3 | - | Antitoxin |
| ITI90_RS11965 (2531605) | 2531605..2531757 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
| ITI90_RS11970 (2532031) | 2532031..2532363 | - | 333 | WP_022620488.1 | DUF6054 family protein | - |
| ITI90_RS11975 (2532390) | 2532390..2532644 | - | 255 | WP_004454592.1 | hypothetical protein | - |
| ITI90_RS11980 (2533076) | 2533076..2533594 | - | 519 | Protein_2281 | RNA-guided endonuclease TnpB family protein | - |
| ITI90_RS11985 (2534067) | 2534067..2534258 | - | 192 | WP_021364351.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| ITI90_RS11990 (2534363) | 2534363..2534740 | - | 378 | WP_021364350.1 | BlaI/MecI/CopY family transcriptional regulator | - |
| ITI90_RS11995 (2535545) | 2535545..2536039 | + | 495 | WP_021364347.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| ITI90_RS12000 (2536400) | 2536400..2536598 | + | 199 | Protein_2285 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T282546 WP_004454589.1 NZ_CP126067:c2531757-2531605 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
Antitoxin
Download Length: 130 bp
>AT282546 NZ_CP126067:2531555-2531684 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|