Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) CD-RCd/-
Location 2531555..2531757 Replicon chromosome
Accession NZ_CP126067
Organism Clostridioides difficile strain CDI-30

Toxin (Protein)


Gene name CD2299.1 Uniprot ID Q185H1
Locus tag ITI90_RS11965 Protein ID WP_004454589.1
Coordinates 2531605..2531757 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name SQ1641
Locus tag -
Coordinates 2531555..2531684 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ITI90_RS11925 (2526804) 2526804..2527121 + 318 WP_009897465.1 hypothetical protein -
ITI90_RS11930 (2527257) 2527257..2527721 + 465 WP_004454576.1 hypothetical protein -
ITI90_RS11935 (2527750) 2527750..2527920 - 171 Protein_2272 cell wall-binding repeat-containing protein -
ITI90_RS11940 (2528050) 2528050..2528211 - 162 WP_004454578.1 hypothetical protein -
ITI90_RS11945 (2528263) 2528263..2528715 - 453 WP_009897470.1 hypothetical protein -
ITI90_RS11950 (2528712) 2528712..2529077 - 366 WP_009897471.1 Bro-N domain-containing protein -
ITI90_RS11955 (2529197) 2529197..2529385 - 189 WP_004454585.1 virulence factor Srl -
ITI90_RS11960 (2530488) 2530488..2531411 - 924 WP_021364626.1 SHOCT domain-containing protein -
- (2531555) 2531555..2531684 + 130 NuclAT_2 - Antitoxin
- (2531555) 2531555..2531684 + 130 NuclAT_3 - Antitoxin
ITI90_RS11965 (2531605) 2531605..2531757 - 153 WP_004454589.1 hypothetical protein Toxin
ITI90_RS11970 (2532031) 2532031..2532363 - 333 WP_022620488.1 DUF6054 family protein -
ITI90_RS11975 (2532390) 2532390..2532644 - 255 WP_004454592.1 hypothetical protein -
ITI90_RS11980 (2533076) 2533076..2533594 - 519 Protein_2281 RNA-guided endonuclease TnpB family protein -
ITI90_RS11985 (2534067) 2534067..2534258 - 192 WP_021364351.1 BlaI/MecI/CopY family transcriptional regulator -
ITI90_RS11990 (2534363) 2534363..2534740 - 378 WP_021364350.1 BlaI/MecI/CopY family transcriptional regulator -
ITI90_RS11995 (2535545) 2535545..2536039 + 495 WP_021364347.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
ITI90_RS12000 (2536400) 2536400..2536598 + 199 Protein_2285 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.92 Da        Isoelectric Point: 10.6365

>T282546 WP_004454589.1 NZ_CP126067:c2531757-2531605 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK

Download         Length: 153 bp

Antitoxin


Download         Length: 130 bp

>AT282546 NZ_CP126067:2531555-2531684 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A125V725

Antitoxin

Download structure file

References