Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 312124..312339 | Replicon | chromosome |
Accession | NZ_CP126067 | ||
Organism | Clostridioides difficile strain CDI-30 |
Toxin (Protein)
Gene name | CD2889 | Uniprot ID | Q183X5 |
Locus tag | ITI90_RS01910 | Protein ID | WP_011861731.1 |
Coordinates | 312124..312267 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd8 | ||
Locus tag | - | ||
Coordinates | 312189..312339 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ITI90_RS01880 (308640) | 308640..308870 | + | 231 | WP_021364192.1 | hemolysin XhlA family protein | - |
ITI90_RS01885 (308890) | 308890..309147 | + | 258 | WP_009898413.1 | phage holin family protein | - |
ITI90_RS01890 (309147) | 309147..309959 | + | 813 | WP_016056343.1 | N-acetylmuramoyl-L-alanine amidase | - |
ITI90_RS01895 (310209) | 310209..310700 | + | 492 | WP_016056344.1 | hypothetical protein | - |
ITI90_RS01900 (310702) | 310702..311268 | + | 567 | WP_016056345.1 | hypothetical protein | - |
ITI90_RS01905 (311678) | 311678..311866 | - | 189 | WP_009898401.1 | hypothetical protein | - |
ITI90_RS01910 (312124) | 312124..312267 | + | 144 | WP_011861731.1 | hypothetical protein | Toxin |
- (312189) | 312189..312339 | - | 151 | NuclAT_1 | - | Antitoxin |
- (312193) | 312193..312339 | - | 147 | NuclAT_0 | - | - |
- (312193) | 312193..312339 | - | 147 | NuclAT_0 | - | - |
ITI90_RS01915 (312775) | 312775..313164 | + | 390 | WP_021376798.1 | BlaI/MecI/CopY family transcriptional regulator | - |
ITI90_RS01920 (313258) | 313258..313641 | + | 384 | WP_021364164.1 | BlaI/MecI/CopY family transcriptional regulator | - |
ITI90_RS01925 (314359) | 314359..315750 | + | 1392 | WP_021364166.1 | metallophosphoesterase | - |
ITI90_RS01930 (315898) | 315898..316206 | - | 309 | WP_021364995.1 | LysR substrate-binding domain-containing protein | - |
ITI90_RS01935 (316243) | 316243..316764 | + | 522 | WP_011860666.1 | chromate transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T282543 WP_011861731.1 NZ_CP126067:312124-312267 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
Antitoxin
Download Length: 151 bp
>AT282543 NZ_CP126067:c312339-312189 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|