282455

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1850025..1850205 Replicon chromosome
Accession NZ_CP125901
Organism Staphylococcus aureus strain CHAL2

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag QM338_RS08945 Protein ID WP_001801861.1
Coordinates 1850025..1850120 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1850148..1850205 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM338_RS08915 1845188..1845838 + 651 WP_001795210.1 excalibur calcium-binding domain-containing protein -
QM338_RS08920 1845919..1846914 + 996 WP_000070642.1 DUF4352 domain-containing protein -
QM338_RS08925 1846989..1847615 + 627 WP_031765202.1 hypothetical protein -
QM338_RS08930 1847656..1847997 + 342 WP_000627540.1 DUF3969 family protein -
QM338_RS08935 1848098..1848670 + 573 WP_283512270.1 hypothetical protein -
QM338_RS08940 1848868..1849880 - 1013 Protein_1758 IS3 family transposase -
QM338_RS08945 1850025..1850120 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1850148..1850205 - 58 - - Antitoxin
QM338_RS08950 1850243..1850344 + 102 WP_001792025.1 hypothetical protein -
QM338_RS08955 1850322..1850483 - 162 Protein_1761 transposase -
QM338_RS08960 1850468..1850878 - 411 WP_001808705.1 IS21 family transposase -
QM338_RS08965 1851420..1852649 - 1230 WP_000072627.1 restriction endonuclease subunit S -
QM338_RS08970 1852642..1854198 - 1557 WP_000028669.1 type I restriction-modification system subunit M -
QM338_RS08975 1854362..1854496 - 135 WP_001791797.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - lukD / hlgA / selk 1844430..1879708 35278


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T282455 WP_001801861.1 NZ_CP125901:1850025-1850120 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT282455 NZ_CP125901:c1850205-1850148 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References