Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1850025..1850205 | Replicon | chromosome |
| Accession | NZ_CP125901 | ||
| Organism | Staphylococcus aureus strain CHAL2 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | QM338_RS08945 | Protein ID | WP_001801861.1 |
| Coordinates | 1850025..1850120 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1850148..1850205 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM338_RS08915 | 1845188..1845838 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| QM338_RS08920 | 1845919..1846914 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| QM338_RS08925 | 1846989..1847615 | + | 627 | WP_031765202.1 | hypothetical protein | - |
| QM338_RS08930 | 1847656..1847997 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| QM338_RS08935 | 1848098..1848670 | + | 573 | WP_283512270.1 | hypothetical protein | - |
| QM338_RS08940 | 1848868..1849880 | - | 1013 | Protein_1758 | IS3 family transposase | - |
| QM338_RS08945 | 1850025..1850120 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1850148..1850205 | - | 58 | - | - | Antitoxin |
| QM338_RS08950 | 1850243..1850344 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| QM338_RS08955 | 1850322..1850483 | - | 162 | Protein_1761 | transposase | - |
| QM338_RS08960 | 1850468..1850878 | - | 411 | WP_001808705.1 | IS21 family transposase | - |
| QM338_RS08965 | 1851420..1852649 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| QM338_RS08970 | 1852642..1854198 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| QM338_RS08975 | 1854362..1854496 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1844430..1879708 | 35278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T282455 WP_001801861.1 NZ_CP125901:1850025-1850120 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT282455 NZ_CP125901:c1850205-1850148 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|