Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1862424..1862606 | Replicon | chromosome |
Accession | NZ_CP125897 | ||
Organism | Staphylococcus aureus strain CHAL4 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | QM341_RS09120 | Protein ID | WP_001801861.1 |
Coordinates | 1862424..1862519 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1862547..1862606 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM341_RS09080 | 1858084..1858710 | + | 627 | WP_000669046.1 | hypothetical protein | - |
QM341_RS09085 | 1858751..1859095 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
QM341_RS09090 | 1859193..1859744 | + | 552 | WP_045189609.1 | hypothetical protein | - |
QM341_RS09095 | 1859962..1860603 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
QM341_RS09100 | 1860717..1860902 | - | 186 | WP_000809857.1 | hypothetical protein | - |
QM341_RS09105 | 1860904..1861080 | - | 177 | WP_000375476.1 | hypothetical protein | - |
QM341_RS09110 | 1861091..1861474 | - | 384 | WP_000070811.1 | hypothetical protein | - |
QM341_RS09115 | 1862078..1862221 | - | 144 | WP_001549059.1 | transposase | - |
QM341_RS09120 | 1862424..1862519 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1862547..1862606 | - | 60 | - | - | Antitoxin |
QM341_RS09125 | 1862642..1862743 | + | 102 | WP_001791893.1 | hypothetical protein | - |
QM341_RS09130 | 1862721..1862897 | - | 177 | Protein_1796 | transposase | - |
QM341_RS09135 | 1863090..1863467 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1855524..1895695 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T282432 WP_001801861.1 NZ_CP125897:1862424-1862519 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT282432 NZ_CP125897:c1862606-1862547 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|