Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 146102..146473 | Replicon | chromosome |
| Accession | NZ_CP124740 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A0D6ZRD3 |
| Locus tag | QI555_RS00755 | Protein ID | WP_001443846.1 |
| Coordinates | 146324..146473 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 146102..146280 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QI555_RS00725 (141854) | 141854..142024 | + | 171 | WP_001625136.1 | protein YnaL | - |
| QI555_RS00730 (142057) | 142057..143430 | + | 1374 | WP_000123746.1 | ATP-dependent RNA helicase DbpA | - |
| QI555_RS00735 (143559) | 143559..144494 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QI555_RS00740 (144546) | 144546..145781 | - | 1236 | WP_000040839.1 | site-specific integrase | - |
| QI555_RS00745 (145783) | 145783..145998 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (146102) | 146102..146280 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (146102) | 146102..146280 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (146102) | 146102..146280 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (146102) | 146102..146280 | + | 179 | NuclAT_0 | - | Antitoxin |
| QI555_RS00750 (146098) | 146098..146286 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| QI555_RS00755 (146324) | 146324..146473 | - | 150 | WP_001443846.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| QI555_RS00760 (146529) | 146529..147338 | - | 810 | WP_000166313.1 | recombination protein RecT | - |
| QI555_RS00765 (147331) | 147331..149931 | - | 2601 | WP_000105140.1 | exodeoxyribonuclease VIII | - |
| QI555_RS00770 (150033) | 150033..150308 | - | 276 | WP_001344816.1 | hypothetical protein | - |
| QI555_RS00775 (150383) | 150383..150553 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| QI555_RS00780 (150553) | 150553..150774 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 144546..193698 | 49152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5383.12 Da Isoelectric Point: 8.3398
>T281147 WP_001443846.1 NZ_CP124740:c146473-146324 [Escherichia coli O157:H7 str. EDL933]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
Download Length: 150 bp
Antitoxin
Download Length: 179 bp
>AT281147 NZ_CP124740:146102-146280 [Escherichia coli O157:H7 str. EDL933]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|