Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4944237..4944839 | Replicon | chromosome |
| Accession | NZ_CP124429 | ||
| Organism | Escherichia coli strain AVS0051 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP74_RS24100 | Protein ID | WP_000897302.1 |
| Coordinates | 4944237..4944548 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP74_RS24105 | Protein ID | WP_000356397.1 |
| Coordinates | 4944549..4944839 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP74_RS24075 (4939720) | 4939720..4940157 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP74_RS24080 (4940202) | 4940202..4941143 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP74_RS24085 (4941207) | 4941207..4942115 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP74_RS24090 (4942172) | 4942172..4943392 | - | 1221 | WP_000343765.1 | ISL3-like element ISEc53 family transposase | - |
| QJP74_RS24095 (4943411) | 4943411..4943929 | - | 519 | WP_000115885.1 | ClbS/DfsB family four-helix bundle protein | - |
| QJP74_RS24100 (4944237) | 4944237..4944548 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP74_RS24105 (4944549) | 4944549..4944839 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP74_RS24110 (4945198) | 4945198..4945476 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP74_RS24115 (4945873) | 4945873..4946091 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP74_RS24120 (4946276) | 4946276..4947016 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP74_RS24125 (4947041) | 4947041..4947889 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP74_RS24130 (4948179) | 4948179..4948421 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP74_RS24135 (4948603) | 4948603..4949532 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 4942172..4943392 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280236 WP_000897302.1 NZ_CP124429:4944237-4944548 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|