Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2894608..2895210 | Replicon | chromosome |
| Accession | NZ_CP124415 | ||
| Organism | Escherichia coli strain AVS0223 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJP60_RS14005 | Protein ID | WP_000897302.1 |
| Coordinates | 2894608..2894919 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJP60_RS14010 | Protein ID | WP_000356397.1 |
| Coordinates | 2894920..2895210 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP60_RS13980 (2890091) | 2890091..2890528 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJP60_RS13985 (2890573) | 2890573..2891514 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJP60_RS13990 (2891578) | 2891578..2892486 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJP60_RS13995 (2892543) | 2892543..2893763 | - | 1221 | WP_000343765.1 | ISL3-like element ISEc53 family transposase | - |
| QJP60_RS14000 (2893782) | 2893782..2894300 | - | 519 | WP_000115885.1 | ClbS/DfsB family four-helix bundle protein | - |
| QJP60_RS14005 (2894608) | 2894608..2894919 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJP60_RS14010 (2894920) | 2894920..2895210 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJP60_RS14015 (2895569) | 2895569..2895847 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJP60_RS14020 (2896244) | 2896244..2896462 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJP60_RS14025 (2896647) | 2896647..2897387 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJP60_RS14030 (2897412) | 2897412..2898260 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJP60_RS14035 (2898550) | 2898550..2898792 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJP60_RS14040 (2898974) | 2898974..2899903 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2892543..2893763 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280124 WP_000897302.1 NZ_CP124415:2894608-2894919 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|