Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2812126..2812728 | Replicon | chromosome |
| Accession | NZ_CP124405 | ||
| Organism | Escherichia coli strain AVS0935 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJB05_RS13560 | Protein ID | WP_000897302.1 |
| Coordinates | 2812126..2812437 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJB05_RS13565 | Protein ID | WP_000356397.1 |
| Coordinates | 2812438..2812728 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB05_RS13535 (2807609) | 2807609..2808046 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJB05_RS13540 (2808091) | 2808091..2809032 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJB05_RS13545 (2809096) | 2809096..2810004 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJB05_RS13550 (2810061) | 2810061..2811281 | - | 1221 | WP_000343765.1 | ISL3-like element ISEc53 family transposase | - |
| QJB05_RS13555 (2811300) | 2811300..2811818 | - | 519 | WP_000115885.1 | ClbS/DfsB family four-helix bundle protein | - |
| QJB05_RS13560 (2812126) | 2812126..2812437 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJB05_RS13565 (2812438) | 2812438..2812728 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJB05_RS13570 (2813087) | 2813087..2813365 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJB05_RS13575 (2813762) | 2813762..2813980 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJB05_RS13580 (2814165) | 2814165..2814905 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJB05_RS13585 (2814930) | 2814930..2815778 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJB05_RS13590 (2816068) | 2816068..2816310 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJB05_RS13595 (2816492) | 2816492..2817421 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2810061..2811281 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280055 WP_000897302.1 NZ_CP124405:2812126-2812437 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|