Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 15401..15659 | Replicon | chromosome |
| Accession | NZ_CP123365 | ||
| Organism | Shigella flexneri strain MMGSG_23 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PFB08_RS00075 | Protein ID | WP_000809168.1 |
| Coordinates | 15401..15553 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 15602..15659 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFB08_RS00055 | 10642..11355 | - | 714 | WP_001102351.1 | acidic protein MsyB | - |
| PFB08_RS00060 | 11381..11785 | - | 405 | WP_000843568.1 | DUF2541 family protein | - |
| PFB08_RS00065 | 12162..14078 | + | 1917 | WP_000516121.1 | molecular chaperone DnaK | - |
| PFB08_RS00070 | 14167..15297 | + | 1131 | WP_001118477.1 | molecular chaperone DnaJ | - |
| PFB08_RS00075 | 15401..15553 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 15602..15659 | + | 58 | - | - | Antitoxin |
| PFB08_RS00080 | 16140..17306 | + | 1167 | WP_000681363.1 | Na+/H+ antiporter NhaA | - |
| PFB08_RS00085 | 17372..18271 | + | 900 | WP_001338226.1 | transcriptional activator NhaR | - |
| PFB08_RS00090 | 18309..18668 | - | 360 | Protein_17 | fimbrial family protein | - |
| PFB08_RS00100 | 19770..20033 | - | 264 | WP_001274022.1 | 30S ribosomal protein S20 | - |
| PFB08_RS00105 | 20136..20354 | + | 219 | WP_011110533.1 | DUF2575 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 18684..19187 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T278941 WP_000809168.1 NZ_CP123365:c15553-15401 [Shigella flexneri]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT278941 NZ_CP123365:15602-15659 [Shigella flexneri]
GTTCAGCATATAGGAGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGAGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|