Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 15401..15659 Replicon chromosome
Accession NZ_CP123365
Organism Shigella flexneri strain MMGSG_23

Toxin (Protein)


Gene name hokC Uniprot ID S1NX00
Locus tag PFB08_RS00075 Protein ID WP_000809168.1
Coordinates 15401..15553 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 15602..15659 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PFB08_RS00055 10642..11355 - 714 WP_001102351.1 acidic protein MsyB -
PFB08_RS00060 11381..11785 - 405 WP_000843568.1 DUF2541 family protein -
PFB08_RS00065 12162..14078 + 1917 WP_000516121.1 molecular chaperone DnaK -
PFB08_RS00070 14167..15297 + 1131 WP_001118477.1 molecular chaperone DnaJ -
PFB08_RS00075 15401..15553 - 153 WP_000809168.1 type I toxin-antitoxin system toxin MokC Toxin
- 15602..15659 + 58 - - Antitoxin
PFB08_RS00080 16140..17306 + 1167 WP_000681363.1 Na+/H+ antiporter NhaA -
PFB08_RS00085 17372..18271 + 900 WP_001338226.1 transcriptional activator NhaR -
PFB08_RS00090 18309..18668 - 360 Protein_17 fimbrial family protein -
PFB08_RS00100 19770..20033 - 264 WP_001274022.1 30S ribosomal protein S20 -
PFB08_RS00105 20136..20354 + 219 WP_011110533.1 DUF2575 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 18684..19187 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5501.57 Da        Isoelectric Point: 7.1312

>T278941 WP_000809168.1 NZ_CP123365:c15553-15401 [Shigella flexneri]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT278941 NZ_CP123365:15602-15659 [Shigella flexneri]
GTTCAGCATATAGGAGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1NX00

Antitoxin

Download structure file

References