27776

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2144738..2144963 Replicon chromosome
Accession NC_017906
Organism Escherichia coli Xuzhou21

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag CDCO157_RS11045 Protein ID WP_000813258.1
Coordinates 2144738..2144893 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2144905..2144963 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CDCO157_RS10995 2139741..2140172 - 432 WP_001302123.1 tellurite resistance protein -
CDCO157_RS11010 2140623..2141336 - 714 WP_000301797.1 helix-turn-helix domain-containing protein -
CDCO157_RS32195 2141472..2141669 - 198 WP_000917763.1 hypothetical protein -
CDCO157_RS11020 2141894..2142448 - 555 WP_000640035.1 DUF1133 family protein -
CDCO157_RS11025 2142511..2142816 - 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
CDCO157_RS11030 2142829..2143878 - 1050 WP_001265229.1 DUF968 domain-containing protein -
CDCO157_RS11035 2143880..2144152 - 273 WP_000191872.1 hypothetical protein -
CDCO157_RS11040 2144274..2144618 - 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
CDCO157_RS11045 2144738..2144893 - 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
- 2144905..2144963 + 59 - - Antitoxin
CDCO157_RS11050 2145184..2145741 - 558 WP_000104474.1 DUF551 domain-containing protein -
CDCO157_RS11055 2145743..2145961 - 219 WP_000683609.1 DUF4014 family protein -
CDCO157_RS11060 2146089..2146400 - 312 WP_001289673.1 hypothetical protein -
CDCO157_RS11065 2146393..2146620 - 228 WP_000699809.1 hypothetical protein -
CDCO157_RS11070 2146617..2146898 - 282 WP_000603384.1 DNA-binding protein -
CDCO157_RS11075 2146931..2147647 - 717 WP_000450627.1 DUF1627 domain-containing protein -
CDCO157_RS32200 2147681..2148142 - 462 WP_000139447.1 replication protein -
CDCO157_RS32205 2148135..2149178 - 1044 WP_001262402.1 hypothetical protein -
CDCO157_RS11090 2149247..2149672 - 426 WP_000693878.1 Rha family transcriptional regulator -
CDCO157_RS11095 2149656..2149898 - 243 WP_000747948.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2107725..2207374 99649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T27776 WP_000813258.1 NC_017906:c2144893-2144738 [Escherichia coli Xuzhou21]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T27776 NC_017906:c2144893-2144738 [Escherichia coli Xuzhou21]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT27776 NC_017906:2144905-2144963 [Escherichia coli Xuzhou21]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References