Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1307184..1307409 | Replicon | chromosome |
Accession | NC_017906 | ||
Organism | Escherichia coli Xuzhou21 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | CDCO157_RS06485 | Protein ID | WP_000813258.1 |
Coordinates | 1307184..1307339 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1307351..1307409 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDCO157_RS06480 | 1306720..1307064 | - | 345 | WP_000756595.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
CDCO157_RS06485 | 1307184..1307339 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 1307351..1307409 | + | 59 | - | - | Antitoxin |
CDCO157_RS06490 | 1307630..1308025 | - | 396 | WP_000426668.1 | hypothetical protein | - |
CDCO157_RS06495 | 1308025..1308924 | - | 900 | WP_014714116.1 | ead/Ea22-like family protein | - |
CDCO157_RS06500 | 1308911..1309195 | - | 285 | WP_001024844.1 | DUF4752 family protein | - |
CDCO157_RS06505 | 1309192..1309413 | - | 222 | WP_000763353.1 | TraR/DksA family transcriptional regulator | - |
CDCO157_RS06510 | 1309461..1310090 | - | 630 | WP_000203859.1 | phage antirepressor Ant | - |
CDCO157_RS28985 | 1311080..1311187 | + | 108 | WP_001273654.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | stx2A / stx2B | 1247081..1312598 | 65517 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T27770 WP_000813258.1 NC_017906:c1307339-1307184 [Escherichia coli Xuzhou21]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T27770 NC_017906:c1307339-1307184 [Escherichia coli Xuzhou21]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT27770 NC_017906:1307351-1307409 [Escherichia coli Xuzhou21]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|