Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1003796..1004610 | Replicon | chromosome |
Accession | NZ_CP122457 | ||
Organism | Salmonella enterica subsp. enterica strain TZ282 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | QCX26_RS04780 | Protein ID | WP_000971655.1 |
Coordinates | 1003796..1004323 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | QCX26_RS04785 | Protein ID | WP_000855694.1 |
Coordinates | 1004320..1004610 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCX26_RS04750 (1000157) | 1000157..1000555 | + | 399 | Protein_930 | cytoplasmic protein | - |
QCX26_RS04755 (1000746) | 1000746..1000985 | + | 240 | Protein_931 | hypothetical protein | - |
QCX26_RS04760 (1001142) | 1001142..1001810 | + | 669 | WP_000445914.1 | hypothetical protein | - |
QCX26_RS04765 (1001837) | 1001837..1002331 | + | 495 | WP_080184759.1 | hypothetical protein | - |
QCX26_RS04770 (1002503) | 1002503..1003159 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
QCX26_RS04775 (1003518) | 1003518..1003723 | + | 206 | Protein_935 | IS5/IS1182 family transposase | - |
QCX26_RS04780 (1003796) | 1003796..1004323 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
QCX26_RS04785 (1004320) | 1004320..1004610 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
QCX26_RS04790 (1004880) | 1004880..1005069 | - | 190 | Protein_938 | IS3 family transposase | - |
QCX26_RS04795 (1005310) | 1005310..1005636 | + | 327 | WP_050067855.1 | hypothetical protein | - |
QCX26_RS04800 (1005909) | 1005909..1006256 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
QCX26_RS04805 (1006241) | 1006241..1006690 | - | 450 | WP_000381616.1 | hypothetical protein | - |
QCX26_RS04810 (1007109) | 1007109..1007552 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
QCX26_RS04815 (1008009) | 1008009..1008659 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1003547..1013972 | 10425 | ||
- | flank | IS/Tn | - | - | 1003547..1003723 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T276947 WP_000971655.1 NZ_CP122457:c1004323-1003796 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |