Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4946800..4947402 | Replicon | chromosome |
| Accession | NZ_CP122454 | ||
| Organism | Escherichia coli strain 82.0311 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QBY76_RS23980 | Protein ID | WP_000897302.1 |
| Coordinates | 4947091..4947402 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QBY76_RS23975 | Protein ID | WP_000356397.1 |
| Coordinates | 4946800..4947090 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY76_RS23950 (4942865) | 4942865..4943767 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QBY76_RS23955 (4943764) | 4943764..4944399 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QBY76_RS23960 (4944396) | 4944396..4945325 | + | 930 | WP_087598274.1 | formate dehydrogenase accessory protein FdhE | - |
| QBY76_RS23965 (4945549) | 4945549..4945767 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| QBY76_RS23970 (4946163) | 4946163..4946441 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QBY76_RS23975 (4946800) | 4946800..4947090 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QBY76_RS23980 (4947091) | 4947091..4947402 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QBY76_RS23985 (4947639) | 4947639..4948859 | - | 1221 | WP_000343766.1 | ISL3-like element ISEc53 family transposase | - |
| QBY76_RS23990 (4948878) | 4948878..4949396 | - | 519 | WP_000115885.1 | ClbS/DfsB family four-helix bundle protein | - |
| QBY76_RS23995 (4949524) | 4949524..4950432 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| QBY76_RS24000 (4950496) | 4950496..4951437 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QBY76_RS24005 (4951482) | 4951482..4951919 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 4947639..4948859 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T276939 WP_000897302.1 NZ_CP122454:c4947402-4947091 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|