Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4987964..4988566 | Replicon | chromosome |
Accession | NZ_CP122451 | ||
Organism | Escherichia coli strain 82.0312 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QBY78_RS24225 | Protein ID | WP_000897302.1 |
Coordinates | 4988255..4988566 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QBY78_RS24220 | Protein ID | WP_000356397.1 |
Coordinates | 4987964..4988254 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBY78_RS24195 (4984029) | 4984029..4984931 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QBY78_RS24200 (4984928) | 4984928..4985563 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QBY78_RS24205 (4985560) | 4985560..4986489 | + | 930 | WP_087598274.1 | formate dehydrogenase accessory protein FdhE | - |
QBY78_RS24210 (4986713) | 4986713..4986931 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
QBY78_RS24215 (4987327) | 4987327..4987605 | - | 279 | WP_001296612.1 | hypothetical protein | - |
QBY78_RS24220 (4987964) | 4987964..4988254 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QBY78_RS24225 (4988255) | 4988255..4988566 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QBY78_RS24230 (4988803) | 4988803..4990023 | - | 1221 | WP_000343766.1 | ISL3-like element ISEc53 family transposase | - |
QBY78_RS24235 (4990042) | 4990042..4990560 | - | 519 | WP_000115885.1 | ClbS/DfsB family four-helix bundle protein | - |
QBY78_RS24240 (4990688) | 4990688..4991596 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
QBY78_RS24245 (4991660) | 4991660..4992601 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QBY78_RS24250 (4992646) | 4992646..4993083 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4988803..4990023 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T276915 WP_000897302.1 NZ_CP122451:c4988566-4988255 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|